OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Jam3 (NM_023277) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR204404
Jam3 (Myc-DDK-tagged) - Mouse junction adhesion molecule 3 (Jam3)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Jam3 or NM_023277"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Jam3
Synonyms 1110002N23Rik; JAM-3; JAM-C; Jcam3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204404 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTGAGCCGGCGGCTGCGACTTCGACTGTACGCGCGGCTGCCTGACTTCTTCCTGCTGCTGCTCT
TCAGGGGCTGCATGATAGAGGCAGTGAATCTCAAATCCAGCAACCGAAACCCAGTGGTACATGAATTTGA
AAGTGTGGAATTGTCTTGCATCATTACGGACTCACAGACAAGTGACCCTAGGATTGAATGGAAGAAAATC
CAAGATGGCCAAACCACATATGTGTATTTTGACAACAAGATTCAAGGAGACCTGGCAGGTCGCACAGATG
TGTTTGGAAAAACTTCCCTGAGGATCTGGAATGTGACACGATCGGATTCAGCCATCTATCGCTGTGAGGT
CGTTGCTCTAAATGACCGAAAAGAAGTTGATGAGATTACCATTGAGTTAATTGTGCAAGTGAAGCCAGTG
ACCCCTGTCTGCAGAATTCCAGCCGCTGTACCTGTAGGCAAGACGGCAACACTGCAGTGCCAAGAGAGCG
AGGGCTATCCCCGGCCTCACTACAGCTGGTACCGCAATGATGTGCCACTGCCTACAGATTCCAGAGCCAA
TCCCAGGTTCCAGAATTCCTCTTTCCATGTGAACTCGGAGACAGGCACTCTGGTTTTCAATGCTGTCCAC
AAGGATGACTCTGGGCAGTACTACTGCATTGCTTCCAATGACGCAGGTGCAGCCAGGTGTGAGGGGCAGG
ACATGGAAGTCTATGATTTGAACATTGCTGGGATTATTGGGGGAGTCCTTGTTGTCCTTATTGTTCTTGC
TGTGATTACGATGGGCATCTGCTGTGCGTACAGACGAGGCTGCTTCATCAGCAGTAAACAAGATGGAGAA
AGCTATAAGAGCCCAGGGAAGCATGACGGTGTTAACTACATCCGGACGAGTGAGGAGGGTGACTTCAGAC
ACAAATCGTCCTTTGTTATC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR204404 protein sequence
Red=Cloning site Green=Tags(s)

MALSRRLRLRLYARLPDFFLLLLFRGCMIEAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKI
QDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPV
TPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVH
KDDSGQYYCIASNDAGAARCEGQDMEVYDLNIAGIIGGVLVVLIVLAVITMGICCAYRRGCFISSKQDGE
SYKSPGKHDGVNYIRTSEEGDFRHKSSFVI

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_023277
ORF Size 930 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_023277.1, NM_023277.2, NM_023277.3, NM_023277.4, NP_075766.1
RefSeq Size 1986 bp
RefSeq ORF 933 bp
Locus ID 83964
UniProt ID Q9D8B7
Cytogenetics 9 A4
MW 34.8 kDa
Summary Mediates cell-cell adhesion. Functions as counter-receptor for JAM2 (PubMed:15372036). Functions as a counter-receptor for ITGAM, mediating leukocyte-platelet interactions and is involved in the regulation of transepithelial migration of polymorphonuclear neutrophils (PMN) (By similarity). Plays a role in angiogenesis (PubMed:15994945). May play a role in the regulation of cell migration (By similarity). Required for normal polarization and acrosome formation in developing spermatids, and for normal male fertility (PubMed:15372036).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_023277" in other vectors (4)
SKU Description Size Price
MC202120 Jam3 (untagged) - Mouse junction adhesion molecule 3 (Jam3), (10ug) 10 ug
$300.00
MG204404 Jam3 (tGFP-tagged) - Mouse junction adhesion molecule 3 (Jam3) 10 ug
$500.00
MR204404L3 Lenti ORF clone of Jam3 (Myc-DDK-tagged) - Mouse junction adhesion molecule 3 (Jam3) 10 ug
$600.00
MR204404L4 Lenti ORF clone of Jam3 (mGFP-tagged) - Mouse junction adhesion molecule 3 (Jam3) 10 ug
$600.00

Plasmid Map for MR204404

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR204404
Circular map for MR204404

file-alt Citations

A novel immunotoxin reveals a new role for CD321 in endothelial cells
Fukuhara, Kim, Hokaiwado et al
PLoS ONE (2017) 12 (10), e0181502 DOI: 10.1371/journal.pone.0181502
AI Summary: OriGene products contributed to this study by providing pCMV6-C-terminal Myc-DDK-tagged ORF clones of mouse CD322 (Jam2, MR204155) and CD323 (Jam3, MR204404), which were used for molecular and functional analyses of endothelial cell proteins.
Snippet: … The pCMV6-C-terminal Myc-DDK-tagged ORF clones of mouse CD322 (Jam2, MR204155) and CD323 (Jam3, MR204404) were purchased from OriGene Technologies, Inc. …The pCMV6-C-terminal Myc-DDK-tagged ORF clones of mouse CD322 (Jam2, MR204155) and CD323 (Jam3, MR204404) were purchased from OriGene Technologies, Inc. …
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products