OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rps2 (BC094058) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR204027
Rps2 (Myc-DDK-tagged) - Mouse ribosomal protein S2 (cDNA clone MGC:102379 IMAGE:3675994)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Rps2 or BC094058"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rps2
Synonyms Llrep3; S4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR204027 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGATGACGCCGGTGCAGCGGGAGGGCCCGGAGGACCCGGGGGCCCAGGATTAGGTGGCCGCGGCG
GCTTCCGCGGAGGATTCGGCAGCGGTCTTAGGGGCCGTGGTCGTGGCCGAGGCCGTGGCCGTGGTCGAGG
CCGCGGGGCTCGTGGAGGTAAAGCTGAAGACAAGGAGTGGATCCCCGTCACCAAGCTGGGCCGTCTGGTT
AAGGACATGAAGATCAAGTCCTTGGAGGAGATCTACCTGTTCTCCCTGCCCATTAAGGAGTCTGAGATCA
TTGATTTCTTCCTGGGTGCATCCCTAAAGGATGAGGTTCTGAAAATCATGCCAGTGCAGAAGCAGACTCG
GGCTGGCCAGCGGACCAGGTTCAAGGCTTTCGTCGCTATTGGGGACTACAATGGTCACGTTGGTCTTGGT
GTTAAGTGCTCCAAGGAGGTTGCCACTGCCATCCGAGGGGCCATCATCTTGGCCAAGCTTTCCATCGTCC
CTGTGCGGAGAGGCTACTGGGGGAACAAGATTGGCAAGCCCCACACTGTTCCATGCAAGGTGACAGGCCG
CTGTGGCTCTGTGCTGGTGCGTCTCATCCCTGCCCCCAGAGGCACTGGCATTGTCTCTGCTCCTGTGCCC
AAGAAGCTCCTGATGATGGCCGGCATAGATGACTGCTACACTTCAGCCAGAGGCTGCACTGCCACCCTGG
GCAACTTTGCTAAGGCCACCTTTGATGCCATCTCCAAGACTTACAGCTACCTGACCCCCGACCTCTGGAA
AGAGACTGTCTTCACCAAGTCTCCTTATCAGGAATTCACGGATCATCTTGTGAAAACCCACACCAGAGTC
TCTGTTCAGAGGACCCAGGCTCCAGCTGTGGCTACCACA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR204027 protein sequence
Red=Cloning site Green=Tags(s)

MADDAGAAGGPGGPGGPGLGGRGGFRGGFGSGLRGRGRGRGRGRGRGRGARGGKAEDKEWIPVTKLGRLV
KDMKIKSLEEIYLFSLPIKESEIIDFFLGASLKDEVLKIMPVQKQTRAGQRTRFKAFVAIGDYNGHVGLG
VKCSKEVATAIRGAIILAKLSIVPVRRGYWGNKIGKPHTVPCKVTGRCGSVLVRLIPAPRGTGIVSAPVP
KKLLMMAGIDDCYTSARGCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRV
SVQRTQAPAVATT

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC094058
ORF Size 879 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC094058, AAH94058
RefSeq Size 957 bp
RefSeq ORF 881 bp
Locus ID 16898
Cytogenetics 17 A3.3
MW 31.2 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC094058" in other vectors (3)
SKU Description Size Price
MG204027 Rps2 (tGFP-tagged) - Mouse ribosomal protein S2 (cDNA clone MGC:102379 IMAGE:3675994) 10 ug
$500.00
MR204027L3 Lenti ORF clone of Rps2 (Myc-DDK-tagged) - Mouse ribosomal protein S2 (cDNA clone MGC:102379 IMAGE:3675994) 10 ug
$600.00
MR204027L4 Lenti ORF clone of Rps2 (mGFP-tagged) - Mouse ribosomal protein S2 (cDNA clone MGC:102379 IMAGE:3675994) 10 ug
$600.00

Plasmid Map for MR204027

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR204027
Circular map for MR204027

file-alt Citations

The Diabetes Gene JAZF1 Is Essential for the Homeostatic Control of Ribosome Biogenesis and Function in Metabolic Stress
Kobiita, Godbersen, Araldi et al
Cell Rep (2020) 32 (1), 107846 DOI: 10.1016/j.celrep.2020.107846
Cited by 59
AI Summary: In this study, OriGene’s Myc-DDK-tagged expression plasmids for Nop56, Tsr3, Rps2, Rps11, Rps14, Rps15, Rps20, Rpl10a, Rpl12, Rpl13, and Rpl13a were used to investigate the role of specific ribosomal proteins and factors in elucidating how JAZF1 regulates ribosome biogenesis and function in pancreatic β-cells under metabolic stress.
Snippet: Jazf1 adenovirus: Ad: Jazf1-HA-tagged This paper N/A Gfp adenovirus: Ad:GFP This paper N/A Nop56 (Myc-DDK-tagged) Origene MR209091 Tsr3 (Myc-DDK-tagged) Origene MR204683 Rps2 (Myc-DDK-tagged) Origene MR204027 Rps11 (Myc-DDK-tagged) Origene MR216516 Rps14 (Myc-DDK-tagged) Origene RC203889 Rps15 (Myc-DDK-tagged) Origene MR200959 Rps20 (Myc-DDK-tagged) Origene MR200561 Rpl10a (Myc-DDK-tagged) Origene MR200782 Rpl12 (Myc-DDK-tagged) Origene MR201323 Rpl13 (Myc-DDK-tagged) Origene MR202263 Rpl13a (Myc-DDK-tagged) Origene MR202103
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products