OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Tnfsf15 (NM_177371) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR203224
Tnfsf15 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA386220 Recombinant Anti-TL1A (Clone TAN2-2)
200 ug
$770.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Tnfsf15 or NM_177371"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tnfsf15
Synonyms Tl1; Tl1a; Tnlg1b; Vegi
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203224 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGAGGAGCTGGGGTTGGGCTTCGGAGAAGGAGTCCCAGTGGAAGTGCTGCCGGAAGGCTGTAGAC
ACAGGCCAGAGGCCAGGGCCGGGCTAGCTGCCAGGAGCAAAGCCTGCCTGGCTCTCACCTGCTGCCTGTT
GTCATTTCCCATCCTCGCAGGACTTAGCACCCTCCTAATGGCTGGCCAGCTCCGGGTCCCCGGAAAAGAC
TGTATGCTTCGGGCCATAACAGAAGAGAGATCTGAGCCTTCACCACAGCAAGTTTACTCACCTCCCAGAG
GCAAGCCGAGAGCACACCTGACAATTAAGAAACAAACCCCAGCACCACATCTGAAAAATCAGCTCTCTGC
TCTACACTGGGAACATGACCTAGGGATGGCCTTCACCAAGAACGGGATGAAGTACATCAACAAATCCCTG
GTGATCCCAGAGTCAGGAGACTATTTCATCTACTCCCAGATCACATTCCGAGGGACCACATCTGTGTGTG
GTGACATCAGTCGGGGGAGACGACCAAACAAGCCAGACTCCATCACCATGGTTATCACCAAGGTAGCAGA
CAGCTACCCTGAGCCTGCCCGCCTACTAACAGGGTCCAAGTCTGTGTGTGAAATAAGCAACAACTGGTTC
CAGTCCCTCTACCTTGGGGCCACGTTCTCCTTGGAAGAAGGAGACAGACTAATGGTAAACGTCAGTGACA
TCTCCTTGGTGGATTACACAAAAGAAGATAAAACTTTCTTTGGAGCTTTCTTGCTA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR203224 protein sequence
Red=Cloning site Green=Tags(s)

MAEELGLGFGEGVPVEVLPEGCRHRPEARAGLAARSKACLALTCCLLSFPILAGLSTLLMAGQLRVPGKD
CMLRAITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSL
VIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITMVITKVADSYPEPARLLTGSKSVCEISNNWF
QSLYLGATFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_177371
ORF Size 756 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_177371.4
RefSeq Size 5828 bp
RefSeq ORF 813 bp
Locus ID 326623
UniProt ID Q5UBV8, F6VXB8, B2RR33
Cytogenetics 4 C1
MW 27.7 kDa
Summary Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis (By similarity). Promotes splenocyte alloactivation.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_177371" in other vectors (4)
SKU Description Size Price
MC207960 Tnfsf15 (untagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), (10ug) 10 ug
$300.00
MG203224 Tnfsf15 (tGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15) 10 ug
$489.00 $500.00
MR203224L3 Lenti ORF clone of Tnfsf15 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15) 10 ug
$600.00
MR203224L4 Lenti ORF clone of Tnfsf15 (mGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15) 10 ug
$600.00

Plasmid Map for MR203224

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR203224
Circular map for MR203224

file-alt Citations

Non-industrial production of therapeutic lentiviral vectors: How to provide vectors to academic CAR-T
Keyer, Syzdykova, Ingirbay et al
Biotechnol Bioeng (2024)
Cited by 6
AI Summary: OriGene’s pLenti-C-Myc-DDK-IRES-Puro plasmid (Cat. PS100069) was used as the parental lentiviral vector backbone in this study to optimize and scale up the academic production of therapeutic lentiviral vectors for CAR-T cell generation.
Snippet: Parent LV is from pLenti-C-Myc-DDK-IRES-Puro (OriGene Cat. PS100069). The parental plasmid already contains a self-inactivating LV with a viral 5′-LTR (R-U5) downstream of the CMV promoter, and 3′-LTR with a deletion (deltaU3-R-U5)
TL1A is an epithelial alarmin that cooperates with IL-33 for initiation of allergic airway inflammation
Schmitt, Duval, Camus et al
J Exp Med (2024) 221 (6) DOI: 10.1084/jem.20231236
Cited by 48
AI Summary: In this study, the OriGene mTL1A-Flag expression vector (catalog #MR203224) was used to ectopically express mouse TL1A protein in epithelial cells, enabling the authors to investigate TL1A's role as an epithelial alarmin in allergic airway inflammation.
Snippet: tor allowing ectopic expression of the mouse TL1A protein (252 aa) tagged at its C-terminus with the epitope Myc-DDK (Flag), under the control of a CMV promoter (mTL1A-Flag vector), was obtained from Origene Technologies (# MR203224). Plasmid pcDNA3.1 (CMV-promoter) was used as a control vector. The U2OS epithelial cell line (# HTB-96;ATCC), an adherent epithelial cell line with 20–60% transfec
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products