OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Mbnl1 (BC096600) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR203170
Mbnl1 (Myc-DDK-tagged) - Mouse muscleblind-like 1 (Drosophila) (cDNA clone MGC:106037 IMAGE:4976244)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Mbnl1 or BC096600"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mbnl1
Synonyms Mbnl, mKIAA0428
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR203170 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCATGCTGGCCCAGCAAATGCAGTTAGCCAATGCCATGATGCCCGGTGCCCCGTTGCAGCCCGTGC
CAATGTTTTCAGTTGCACCAAGCTTAGCCACCAGTGCATCAGCAGCCTTTAACCCTTACCTGGGGCCTGT
TTCCCCAAGCCTGGTTCCAGCAGAGATCTTGCCGACTGCACCAATGTTGGTCACGGGGAATCCTGGAGTT
CCAGTGCCAGCAGCTGCCGCAGCTGCTGCACAGAAGTTAATGCGGACAGACAGACTGGAGGTGTGTCGAG
AGTACCAGCGTGGCAATTGCAACAGAGGAGAAAATGACTGTCGGTTTGCTCATCCTGCTGACAGCACAAT
GATTGATACCAATGACAACACAGTCACTGTCTGCATGGATTACATCAAGGGGAGATGCTCTCGGGAAAAG
TGCAAATACTTCCATCCTCCCGCACACCTGCAAGCCAAGATCAAGGCTGCCCAATACCAGGTCAACCAGG
CTGCAGCAGCACAGGCTGCAGCTACTGCAGCTGCCATGGGAATTCCTCAAGCTGTACTTCCCCCATTGCC
AAAGAGGCCTGCTCTTGAAAAAACCAACGGTGCCACCGCAGTCTTTAACACTGGTATTTTCCAATACCAA
CAGGCTCTAGCCAACATGCAGTTACAGCAGCATACAGCATTTCTCCCACCAGGCTCAATATTGTGCATGA
CACCCGCTACAAGTGTTGATACCCATAATATCTGCCGAACATCTGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR203170 protein sequence
Red=Cloning site Green=Tags(s)

MAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATSASAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGV
PVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREK
CKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQ
QALANMQLQQHTAFLPPGSILCMTPATSVDTHNICRTSD

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC096600
ORF Size 747 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC096600, AAH96600
RefSeq Size 4055 bp
RefSeq ORF 749 bp
Locus ID 56758
Cytogenetics 3 D
MW 26.4 kDa
Summary Mediates pre-mRNA alternative splicing regulation. Acts either as activator or repressor of splicing on specific pre-mRNA targets. Inhibits cardiac troponin-T (TNNT2) pre-mRNA exon inclusion but induces insulin receptor (IR) pre-mRNA exon inclusion in muscle. Antagonizes the alternative splicing activity pattern of CELF proteins. Regulates the TNNT2 exon 5 skipping through competition with U2AF2. Inhibits the formation of the spliceosome A complex on intron 4 of TNNT2 pre-mRNA. Binds to the stem-loop structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Binds to the 5'-YGCU(U/G)Y-3'consensus sequence. Binds to the IR RNA. Binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC096600" in other vectors (4)
SKU Description Size Price
MC218336 Mbnl1 (untagged) - Mouse muscleblind-like 1 (Drosophila) (cDNA clone MGC:106037 IMAGE:4976244), (10ug) 10 ug
$330.00
MG203170 Mbnl1 (tGFP-tagged) - Mouse muscleblind-like 1 (Drosophila) (cDNA clone MGC:106037 IMAGE:4976244) 10 ug
$500.00
MR203170L3 Lenti ORF clone of Mbnl1 (Myc-DDK-tagged) - Mouse muscleblind-like 1 (Drosophila) (cDNA clone MGC:106037 IMAGE:4976244) 10 ug
$600.00
MR203170L4 Lenti ORF clone of Mbnl1 (mGFP-tagged) - Mouse muscleblind-like 1 (Drosophila) (cDNA clone MGC:106037 IMAGE:4976244) 10 ug
$600.00

Plasmid Map for MR203170

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR203170
Circular map for MR203170

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products