OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Nfu1 (NM_020045) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201993
Nfu1 (Myc-DDK-tagged) - Mouse NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) (Nfu1), nuclear gene encoding mitochondrial protein, transcript variant 2
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Nfu1 or NM_020045"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nfu1
Synonyms 0610006G17Rik; CGI-33; Hirip5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201993 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTATTCAAACACAAGACACCCCAAATCCCAACAGCTTAAAGTTTATACCAGGAAAGCCGGTTCTTG
AGACGAGGACCATGGATTTCCCCACCCCTGCTGCAGCTTTCCGCTCCCCTCTGGCCAGGCAGTTATTCAG
AATTGAAGGTGTGAAAAGCGTCTTCTTCGGACCAGATTTCATCACAGTCACAAAGGAGAATGAAGAGTTA
GACTGGAATTTACTGAAACCAGACATTTATGCCACAATTATGGACTTCTTTGCATCTGGCTTACCCCTAG
TGACCGAGGAGACGCCTCCGCCTCCGGGAGAAGCAGGCTCTGAGGAAGATGACGAAGTCGTGGCAATGAT
TAAAGAACTGCTAGATACTAGAATAAGGCCAACTGTGCAGGAGGATGGGGGCGACGTGATCTACAGGGGC
TTTGAAGATGGCATCGTGCGGCTGAAGCTCCAGGGCTCCTGCACCAGCTGCCCCAGCTCCATCATCACCC
TGAAGAGCGGGATTCAGAACATGCTGCAGTTTTATATTCCAGAAGTGGAAGGTGTGGAGCAGGTGATGGA
TGATGACGAATCAGATGAAAAAGAAGCAAATTCATCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201993 protein sequence
Red=Cloning site Green=Tags(s)

MFIQTQDTPNPNSLKFIPGKPVLETRTMDFPTPAAAFRSPLARQLFRIEGVKSVFFGPDFITVTKENEEL
DWNLLKPDIYATIMDFFASGLPLVTEETPPPPGEAGSEEDDEVVAMIKELLDTRIRPTVQEDGGDVIYRG
FEDGIVRLKLQGSCTSCPSSIITLKSGIQNMLQFYIPEVEGVEQVMDDDESDEKEANSS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_020045
ORF Size 597 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020045.2, NP_064429.1
RefSeq Size 965 bp
RefSeq ORF 768 bp
Locus ID 56748
UniProt ID Q9QZ23
Cytogenetics 6 D1
MW 22.1 kDa
Summary Iron-sulfur cluster scaffold protein which can assemble 4Fe-4S clusters and deliver them to target proteins.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_020045" in other vectors (4)
SKU Description Size Price
MC203723 Nfu1 (untagged) - Mouse NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) (Nfu1), nuclear gene encoding mitochondrial protein, transcript variant 2, (10ug) 10 ug
$300.00
MG201993 Nfu1 (tGFP-tagged) - Mouse NFU1 iron-sulfur cluster scaffold homolog (S 10 ug
$500.00
MR201993L3 Lenti ORF clone of Nfu1 (Myc-DDK-tagged) - Mouse NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) (Nfu1), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$600.00
MR201993L4 Lenti ORF clone of Nfu1 (mGFP-tagged) - Mouse NFU1 iron-sulfur cluster scaffold homolog (S. cerevisiae) (Nfu1), nuclear gene encoding mitochondrial protein, transcript variant 2 10 ug
$600.00

Plasmid Map for MR201993

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201993
Circular map for MR201993

file-alt Citations

Assembly of the [4Fe-4S] cluster of NFU1 requires the coordinated donation of two [2Fe-2S] clusters from the scaffold proteins, ISCU2 and ISCA1
Jain, Singh, Maio et al
Hum. Mol. Genet. (2020)
Cited by 27
AI Summary: OriGene's pCMV6-Entry vectors were used in this study to express full-length genes of interest in human cells, enabling the investigation of protein interactions and functions related to Fe-S cluster assembly in NFU1.
Snippet: UNCORRECTED MANUSCRIPT 21 Cloning and plasmid constructs The plasmids used to transfect human cells were all pCMV6-Entry based vectors (Origene) to allow the expression of the full-length gene of interest under the CMV promoter (Table S1). The constructs
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products