OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Selenos (NM_024439) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201787
Txnrd1 (Myc-DDK-tagged) - Mouse thioredoxin reductase 1 (Txnrd1), transcript variant 1, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
  $118.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Selenos or NM_024439"

Specifications
Specifications
Product Data
Type Mouse Untagged ORF Clone
Target Symbol Selenos
Synonyms 1500011E07Rik; C78786; H-4; H-47; H4; H47; Se; Sels; Seps1; V; Vimp
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201787 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCGCGATGAGGAACCTCTGTCTCCGAGGCCGGCGCTGGAGACCGAGAGCCTGCGATTCCTGCACG
TGACAGTGGGCTCCCTGCTGGCCAGCTATGGCTGGTACATCCTCTTCAGCTGCATCCTACTCTACATTGT
CATCCAGAGGCTCTCCCTTCGACTGAGGGCTTTGAGGCAGAGACAGCTGGACCAAGCCGAGACTGTTCTG
GAACCTGATGTTGTTGTTAAGCGACAAGAGGCTTTAGCAGCTGCTCGTTTGAGAATGCAGGAAGATCTAA
ATGCCCAAGTTGAAAAACATAAGGAAAAACTAAGACAGCTTGAAGAAGAAAAAAGAAGACAGAAGATTGA
AATGTGGGACAGCATGCAAGAAGGCAGAAGTTACAAAAGAAATTCAGGAAGGCCTCAGGAAGAAGATGGT
CCTGGACCTTCTACTTCATCTGTCATCCCCAAAGGAAAATCTGACAAAAAGCCTTTGCGAGGAGGTGGTT
ATAACCCTCTGACGGGTGAAGGGGGTGGAACCTGCTCCTGGAGACCTGGACGCAGGGGCCCATCATCTGG
TGGA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201787 protein sequence
Red=Cloning site Green=Tags(s)

MDRDEEPLSPRPALETESLRFLHVTVGSLLASYGWYILFSCILLYIVIQRLSLRLRALRQRQLDQAETVL
EPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKLRQLEEEKRRQKIEMWDSMQEGRSYKRNSGRPQEEDG
PGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPGRRGPSSGG

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024439
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024439.2
RefSeq Size 1208 bp
RefSeq ORF 573 bp
Locus ID 109815
UniProt ID Q9BCZ4
Cytogenetics 7 35.49 cM
Summary This gene encodes a transmembrane protein that is localized in the endoplasmic reticulum (ER). It is involved in the degradation process of misfolded proteins in the ER, and may also have a role in inflammation control. This protein is a selenoprotein, containing the rare amino acid selenocysteine (Sec). Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Two additional phylogenetically conserved stem-loop structures (Stem-loop 1 and Stem-loop 2) in the 3' UTR of this mRNA have been shown to function as modulators of Sec insertion (PMID:23614019). Alternatively spliced transcript variants have been found for this gene. provided by RefSeq, Jul 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_024439" in other vectors (2)
SKU Description Size Price
MC203796 Vimp (untagged) - Mouse histocompatibility 47 (H47), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$242.00
MG201787 Vimp (GFP-tagged) - Mouse histocompatibility 47 (H47), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$318.00

Plasmid Map for MR201787

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201787
Circular map for MR201787

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products