OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Bnip3 (NM_009760) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201757
Bnip3 (Myc-DDK-tagged) - Mouse BCL2/adenovirus E1B interacting protein 3 (Bnip3), nuclear gene encoding mitochondrial protein
Interest in protein/lysate? Submit request here!
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Bnip3 or NM_009760"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Bnip3
Synonyms Nip3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201757 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCAGAGCGGGGAGGAGAACCTGCAGGGCTCCTGGGTAGAACTGCACTTCAGCAATGGCAATGGGA
GCAGCGTTCCAGCCTCCGTCTCTATTTATAATGGTGACATGGAAAAAATACTGTTGGATGCCCAGCATGA
ATCTGGACGAAGTAGCTCCAAGAGTTCTCACTGTGACAGCCCACCTCGCTCCCAGACACCACAAGATACC
AACAGAGCTGAAATAGACAGCCACAGCTTTGGCGAGAAAAACAGCACTCTGTCTGAGGAAGATTATATTG
AGAGAAGAAGAGAAGTTGAAAGTATCCTGAAGAAAAACTCAGATTGGATATGGGATTGGTCAAGTCGACC
AGAAAATATTCCCCCCAAGGAGTTCCTTTTTAAACACCCGAAGCGCACAGCTACTCTCAGCATGAGAAAC
ACAAGCGTTATGAAGAAAGGGGGAATTTTCTCAGCAGACTTTCTGAAGGTTTTCCTTCCATCTCTGTTAC
TGTCTCATCTGCTGGCCATTGGCTTGGGGATCTACATTGGAAGGCGTCTGACAACTTCCACTAGCACCTT
C

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201757 protein sequence
Red=Cloning site Green=Tags(s)

MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDSPPRSQTPQDT
NRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENIPPKEFLFKHPKRTATLSMRN
TSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRLTTSTSTF

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009760
ORF Size 561 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009760.4, NP_033890.1
RefSeq Size 1756 bp
RefSeq ORF 564 bp
Locus ID 12176
UniProt ID O55003
Cytogenetics 7 F4
MW 21 kDa
Summary Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2 (By similarity). Involved in mitochondrial quality control via its interaction with SPATA18/MIEAP: in response to mitochondrial damage, participates in mitochondrial protein catabolic process (also named MALM) leading to the degradation of damaged proteins inside mitochondria. The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane may play a critical role in the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity). The physical interaction of SPATA18/MIEAP, BNIP3 and BNIP3L/NIX at the mitochondrial outer membrane regulates the opening of a pore in the mitochondrial double membrane in order to mediate the translocation of lysosomal proteins from the cytoplasm to the mitochondrial matrix (By similarity). Plays an important role in the calprotectin (S100A8/A9)-induced cell death pathway (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009760" in other vectors (3)
SKU Description Size Price
MC203253 Bnip3 (untagged) - Mouse BCL2/adenovirus E1B interacting protein 3 (Bnip3), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$300.00
MR201757L3 Lenti ORF clone of Bnip3 (Myc-DDK-tagged) - Mouse BCL2/adenovirus E1B interacting protein 3 (Bnip3), nuclear gene encoding mitochondrial protein 10 ug
$600.00
MR201757L4 Lenti ORF clone of Bnip3 (mGFP-tagged) - Mouse BCL2/adenovirus E1B interacting protein 3 (Bnip3), nuclear gene encoding mitochondrial protein 10 ug
$600.00

Plasmid Map for MR201757

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201757
Circular map for MR201757

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products