OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Vhl (NM_009507) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201630
Vhl (Myc-DDK-tagged) - Mouse von Hippel-Lindau tumor suppressor (Vhl)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Vhl or NM_009507"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Vhl
Synonyms Vhlh
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201630 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCCGGAAGGCAGCCAGTCCAGAGGAGGCGGCGGGGGAGCCCGGTCCTGAGGAGATGGAGGCTGGGC
GGCCGCGGCCGGTGCTGCGCTCGGTGAACTCGCGCGAGCCCTCTCAGGTCATCTTCTGCAACCGCAGCCC
GCGCGTCGTGCTGCCTTTGTGGCTCAACTTCGACGGCGAGCCTCAGCCCTACCCGATCTTACCACCGGGC
ACCGGCCGCCGCATCCACAGCTACCGAGGTCATCTTTGGCTCTTCAGGGATGCGGGGACCCATGATGGAC
TTCTGGTTAACCAAACGGAGCTGTTTGTGCCATCCCTCAATGTCGATGGACAGCCTATTTTTGCCAACAT
CACATTGCCAGTGTATACCCTGAAAGAGCGGTGCCTTCAGGTTGTGCGGAGCCTGGTCAAGCCTGAGAAC
TACAGGAGACTGGACATCGTCAGGTCACTCTATGAGGATTTGGAGGACTACCCAAGTGTGCGGAAGGACA
TACAGCGACTGAGCCAAGAGCACCTTGAGAGTCAGCACCTGGAAGAGGAGCCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201630 protein sequence
Red=Cloning site Green=Tags(s)

MPRKAASPEEAAGEPGPEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGEPQPYPILPPG
TGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPEN
YRRLDIVRSLYEDLEDYPSVRKDIQRLSQEHLESQHLEEEP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009507
ORF Size 543 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009507.4
RefSeq Size 2730 bp
RefSeq ORF 546 bp
Locus ID 22346
UniProt ID P40338
Cytogenetics 6 52.81 cM
MW 20.8 kDa
Summary Involved in the ubiquitination and subsequent proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Seems to act as a target recruitment subunit in the E3 ubiquitin ligase complex and recruits hydroxylated hypoxia-inducible factor (HIF) under normoxic conditions. Involved in transcriptional repression through interaction with HIF1A, HIF1AN and histone deacetylases. Ubiquitinates, in an oxygen-responsive manner, ADRB2 (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009507" in other vectors (4)
SKU Description Size Price
MC209640 Vhl (untagged) - Mouse von Hippel-Lindau tumor suppressor (Vhl), (10ug) 10 ug
$300.00
MG201630 Vhl (tGFP-tagged) - Mouse von Hippel-Lindau syndrome homolog (Vhlh) 10 ug
$500.00
MR201630L3 Lenti ORF clone of Vhl (Myc-DDK-tagged) - Mouse von Hippel-Lindau tumor suppressor (Vhl) 10 ug
$600.00
MR201630L4 Lenti ORF clone of Vhl (mGFP-tagged) - Mouse von Hippel-Lindau tumor suppressor (Vhl) 10 ug
$600.00

Plasmid Map for MR201630

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201630
Circular map for MR201630

file-alt Citations

VHL loss enhances antitumor immunity by activating the anti-viral DNA-sensing pathway
Jiao, Hu, Pan et al
iScience (2024) 27 (7), 110285 DOI: 10.1016/j.isci.2024.110285
Cited by 10
AI Summary: OriGene's HA-tagged mouse VHL ORF Clone (Cat #MR201630) was used in this study to investigate the role of VHL in regulating antitumor immunity and the activation of the anti-viral DNA-sensing pathway.
Snippet: HA-VHL-pRC/CMV Addgene #19999;RRID:Addgene_19999 pcDNA3-HA-HIF1α(P402A/P564A) Addgene #18955;RRID:Addgene_18955 pcDNA3-HA-HIF2α(P405A/P531A) Addgene #18956;RRID:Addgene_18956 HA-tagged mouse VHL ORF Clone Origene Cat #MR201630 LentiORF pLEX vector Thermo Scientific Cat #OHS4735
VHL loss enables immune checkpoint blockade therapy by boosting type I interferon response
Jiao, Bao, Hu et al
bioRxiv (2023)
Cited by 1
Snippet: Specifically, we used HA-VHL-pRC/CMV (Addgene #19999) and HA-tagged mouse VHL ORF Clone (Origene;Cat #MR201630) as templates to amplify human and mouse VHL, respectively. In addition, we amplified mutant human HIF1/2α using the pcDNA3-HA-HIF1α(P402A/P564A) (Addgene #18955) plasmid and the
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products