OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cnbp (NM_013493) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR201568
Cnbp (Myc-DDK-tagged) - Mouse cellular nucleic acid binding protein (Cnbp), transcript variant 1
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Cnbp or NM_013493"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cnbp
Synonyms AA408710; Cnbp1; Znf9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201568 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGCAACGAATGCTTCAAGTGTGGACGATCTGGCCACTGGGCCAGGGAGTGCCCTACTGGTGGAG
GTCGGGGTCGTGGAATGAGAAGCCGCGGCAGAGGTGGTTTTACCTCGGATAGAGGGTTCCAGTTTGTTTC
CTCGTCTCTCCCTGACATCTGCTACCGCTGTGGTGAGTCTGGTCATCTTGCCAAGGATTGTGATCTGCAG
GAGGATGAAGCCTGCTATAACTGCGGTAGAGGTGGCCACATTGCCAAGGACTGCAAGGAGCCCAAGAGAG
AGCGAGAGCAATGCTGCTACAATTGTGGCAAGCCAGGCCATCTGGCTCGTGACTGTGACCACGCGGATGA
GCAGAAGTGCTATTCTTGTGGTGAATTTGGACATATTCAAAAAGACTGCACCAAGGTGAAGTGCTATAGG
TGTGGTGAAACTGGTCATGTAGCCATCAATTGCAGCAAGACAAGTGAAGTCAACTGTTACCGCTGTGGCG
AGTCAGGGCATCTTGCACGGGAATGCACAATTGAGGCTACAGCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201568 protein sequence
Red=Cloning site Green=Tags(s)

MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQ
EDEACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYR
CGETGHVAINCSKTSEVNCYRCGESGHLARECTIEATA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_013493
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013493.3
RefSeq Size 2178 bp
RefSeq ORF 537 bp
Locus ID 12785
UniProt ID P53996
Cytogenetics 6 D1
MW 19.6 kDa
Summary Single-stranded DNA-binding protein, with specificity to the sterol regulatory element (SRE). Involved in sterol-mediated repression.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_013493" in other vectors (4)
SKU Description Size Price
MC202490 Cnbp (untagged) - Mouse cellular nucleic acid binding protein (Cnbp), transcript variant 1, (10ug) 10 ug
$300.00
MG201568 Cnbp (tGFP-tagged) - Mouse cellular nucleic acid binding protein (Cnbp) 10 ug
$500.00
MR201568L3 Lenti ORF clone of Cnbp (Myc-DDK-tagged) - Mouse cellular nucleic acid binding protein (Cnbp), transcript variant 1 10 ug
$600.00
MR201568L4 Lenti ORF clone of Cnbp (mGFP-tagged) - Mouse cellular nucleic acid binding protein (Cnbp), transcript variant 1 10 ug
$600.00

Plasmid Map for MR201568

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR201568
Circular map for MR201568

file-alt Citations

An antisense transcript transcribed from Irs2 locus contributes to the pathogenesis of hepatic steatosis in insulin resistance
Matsushita, Awazawa, Kobayashi et al
Cell Chem Biol (2021) 29 (4), 680-689.e6 DOI: 10.1016/j.chembiol.2021.12.008
Cited by 4
AI Summary: OriGene’s Mouse Tagged ORF Clones for Hars2 (MR208134), Cnbp (MR201568), and Tsn (MR202740) were used to study the roles of these genes in the regulation of hepatic steatosis and insulin resistance mechanisms described in the paper.
Snippet: Recombinant DNA Hars2 (NM_080636) Mouse Tagged ORF Clone ORIGENE MR208134 Cnbp (NM_013493) Mouse Tagged ORF Clone ORIGENE MR201568 Tsn (NM_011650) Mouse Tagged ORF Clone ORIGENE MR202740
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products