OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Ube2i (BC037635) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR200308
Ube2i (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $289.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Ube2i or BC037635"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ube2i
Synonyms Mmubc9, UBC9, 5830467E05Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200308 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGGGATCGCCCTCAGCCGCCTTGCGCAGGAAAGGAAAGCCTGGAGGAAGGACCACCCTTTTGGCT
TTGTAGCTGTCCCAACAAAGAACCCTGATGGCACAATGAACCTGATGAACTGGGAGTGCGCTATCCCTGG
AAAGAAGGGGACTCCATGGGAAGGAGGCTTGTTCAAGCTACGGATGCTTTTCAAAGATGACTATCCGTCC
TCACCACCAAAATGTAAGTTGTGCAAAGAGCCTGCAGTCCACTTCCCAGCACTACCACCACCCTTTGGGA
GCCATGTCTGTGAGTGCTTGGCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR200308 protein sequence
Red=Cloning site Green=Tags(s)

MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPS
SPPKCKLCKEPAVHFPALPPPFGSHVCECLA

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN BC037635
ORF Size 303 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC037635, AAH37635
RefSeq Size 2252 bp
RefSeq ORF 305 bp
Locus ID 22196
Cytogenetics 17 A3.3
MW 11.2 kDa
Summary Accepts the ubiquitin-like proteins SUMO1, SUMO2 and SUMO3 from the UBLE1A-UBLE1B E1 complex and catalyzes their covalent attachment to other proteins with the help of an E3 ligase such as RANBP2, CBX4 and ZNF451. Can catalyze the formation of poly-SUMO chains. Essential for nuclear architecture, chromosome segregation and embryonic viability. Necessary for sumoylation of FOXL2 and KAT5 (By similarity). Sumoylates p53/TP53 at 'Lys-386'.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"BC037635" in other vectors (4)
SKU Description Size Price
MC206861 Ube2i (untagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933), (10ug) 10 ug
$165.00
MG200308 Ube2i (tGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933) 10 ug
$350.00
MR200308L3 Lenti ORF clone of Ube2i (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933) 10 ug
$450.00
MR200308L4 Lenti ORF clone of Ube2i (mGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2I (cDNA clone MGC:46871 IMAGE:4951933) 10 ug
$450.00

Plasmid Map for MR200308

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR200308
Circular map for MR200308

file-alt Citations

SUMOylation regulates insulin exocytosis downstream of secretory granule docking in rodents and humans
Dai, Plummer, Casimir et al
Diabetes (2011) 60 (3), 838-47 DOI: 10.2337/db10-0440
Cited by 94
AI Summary: OriGene products contributed human SUMO1, Ubc9, and SENP1 constructs (in the pCMV6-XL4 vector), which were used to manipulate and study the SUMOylation pathway’s effects on insulin secretion and β-cell exocytosis in this research.
Snippet: The human SUMO1, Ubc9, and SENP1 constructs were in the pCMV6-XL4 vector and were from Origene Technologies (Rockville, MD). ... 2E). Some Munc18a may be pulled down with syntaxin-1A independent of the SNARE complex.
FigureFigureFigure
SUMOylation regulates Kv2.1 and modulates pancreatic beta-cell excitability
Dai, Kolic, Marchi et al
J Cell Sci (2009) 122 (Pt 6), 775-9 DOI: 10.1242/jcs.036632
Cited by 88
AI Summary: In this study, OriGene’s SUMO1-YFP (Cat# RG204480) and Ubc9 (Cat# SC119549) expression plasmids were used to investigate how SUMOylation modulates Kv2.1 channel function and pancreatic beta-cell excitability.
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products