OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Cenps (NM_027263) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG221175
Apitd1 (tGFP-tagged) - Mouse apoptosis-inducing TAF9-like domain 1 (Apitd1), (10ug)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
tGFP DDK
AAV Particle:
DDK
  $350.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Cenps or NM_027263"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cenps
Synonyms 2610040C18Rik; 2810407L01Rik; CENP-S
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG221175 representing NM_027263
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGGTGGAGGCTGAGGAGCCGCAGGAGTTCTCTCACCGGCAGAGGCTGAAGGCGGCAGTTCACT
ACACGGTCGGCTGTCTCTGCCAGGAAGTCACGCTGAACAAACAGGTGAACTTCAGCAAACAGACCATCGC
GGCGATCTCCGAGGTGACTTTTCGACAGTGCGAAAATTTTGCCAAAGACCTTGAAATGTTTGCCAGACAC
GCGAAAAGAAGCACGGTCACCACTGAAGACGTGAAGCTCTTAGCCAGGCGAAATAATTCACTGCTAAAAT
ACATTACAGAGAAGAATGAAGAGATTGCCCAGCTTAACCTGAAACGAAAGGCCAAGAAGAAAAGAAAGCC
GGAAGATGAAAGCAGGAGCTCTCGGGAGTCCATGGCTGAGGAGCTGGACGGGGCTGAGGAGCTGCAGAGC
GAGAGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG221175 representing NM_027263
Red=Cloning site Green=Tags(s)

MEEVEAEEPQEFSHRQRLKAAVHYTVGCLCQEVTLNKQVNFSKQTIAAISEVTFRQCENFAKDLEMFARH
AKRSTVTTEDVKLLARRNNSLLKYITEKNEEIAQLNLKRKAKKKRKPEDESRSSRESMAEELDGAEELQS
ES

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_027263
ORF Size 426 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027263.2, NP_081539.1
RefSeq Size 930 bp
RefSeq ORF 429 bp
Locus ID 69928
UniProt ID Q9D084
Cytogenetics 4 E2
Summary DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage. In complex with CENPX (MHF heterodimer), crucial cofactor for FANCM in both binding and ATP-dependent remodeling of DNA. Stabilizes FANCM. In complex with CENPX and FANCM (but not other FANC proteins), rapidly recruited to blocked forks and promotes gene conversion at blocked replication forks. In complex with CENPT, CENPW and CENPX (CENP-T-W-S-X heterotetramer), involved in the formation of a functional kinetochore outer plate, which is essential for kinetochore-microtubule attachment and faithful mitotic progression. As a component of MHF and CENP-T-W-S-X complexes, binds DNA and bends it to form a nucleosome-like structure. DNA-binding function is fulfilled in the presence of CENPX, with the following preference for DNA substates: Holliday junction > double-stranded > splay arm > single-stranded. Does not bind DNA on its own.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_027263" in other vectors (4)
SKU Description Size Price
MC211020 Apitd1 (untagged) - Mouse apoptosis-inducing, TAF9-like domain 1 (Apitd1), (10ug) 10 ug
$165.00
MR221175 Apitd1 (Myc-DDK-tagged) - Mouse apoptosis-inducing, TAF9-like domain 1 (Apitd1) 10 ug
$289.00
MR221175L3 Lenti ORF clone of Apitd1 (Myc-DDK-tagged) - Mouse apoptosis-inducing, TAF9-like domain 1 (Apitd1) 10 ug
$450.00
MR221175L4 Lenti ORF clone of Apitd1 (mGFP-tagged) - Mouse apoptosis-inducing, TAF9-like domain 1 (Apitd1) 10 ug
$450.00

Plasmid Map for MG221175

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG221175
Circular map for MG221175

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products