OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Selenow (NM_009156) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MG200204
Sepw1 (GFP-tagged) - Mouse selenoprotein W, muscle 1 (Sepw1), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
  $318.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (4)

TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "Selenow or NM_009156"

Specifications
Specifications
Product Data
Type Mouse Untagged ORF Clone
Target Symbol Selenow
Synonyms selW; Sep; Sepw1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200204 representing NM_009156
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGCTCGCCGTTCGAGTCGTGTATTGTGGAGCTTGAGGCTATAAGCCCAAGTACCTCCAGCTCAAGG
AGAAGCTAGAACATGAGTTCCCCGGATGCCTGGACATTTGTGGCGAGGGGACTCCCCAGGTCACCGGGTT
CTTTGAAGTGACAGTAGCCGGGAAGTTGGTCCACTCCAAGAAGAGAGGTGATGGCTATGTGGATACAGAG
AGCAAGTTCCGGAAACTGGTGACCGCCATCAAAGCTGCCTTGGCTCAGTGCCAG

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200204 representing NM_009156
Red=Cloning site Green=Tags(s)

MALAVRVVYCGA*GYKPKYLQLKEKLEHEFPGCLDICGEGTPQVTGFFEVTVAGKLVHSKKRGDGYVDTE
SKFRKLVTAIKAALAQCQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_009156
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info The expression of this clone is not guaranteed due to the nature of selenoproteins.
OTI Annotation This clone encodes a selenoprotein containing the rare amino acid selenocysteine (Sec). Sec is encoded by UGA codon, which normally signals translational termination. Expression of this clone is not guaranteed due to the nature of selenoproteins.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009156.2, NP_033182.1
RefSeq Size 722 bp
RefSeq ORF 267 bp
Locus ID 20364
UniProt ID P63300
Cytogenetics 7 A2
Summary This gene encodes a selenoprotein containing a selenocysteine (Sec) residue, which is encoded by the UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein is highly expressed in skeletal muscle and brain. It belongs to the SelWTH family, which possesses a thioredoxin-like fold and a conserved CxxU (C is cysteine, U is Sec) motif, and has been shown to function as a glutathione-dependent antioxidant in vivo. Studies in mouse suggest that this selenoprotein is involved in muscle growth and differentiation, and in the protection of neurons from oxidative stress during neuronal development. provided by RefSeq, Apr 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_009156" in other vectors (2)
SKU Description Size Price
MC202669 Sepw1 (untagged) - Mouse selenoprotein W, muscle 1 (Sepw1), (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$242.00
MR200204 Txnrd3 (Myc-DDK-tagged) - Mouse thioredoxin reductase 3 (Txnrd3), transcript variant 1, (10ug), (Note: selenocysteine protein, Internal stop codon present. see reference data summary below) 10 ug
$118.00

Plasmid Map for MG200204

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MG200204
Circular map for MG200204

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products