OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

AP2 alpha (TFAP2A) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA330109
Rabbit Polyclonal Anti-TFAP2A Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $525.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY420895 Transient overexpression lysate of transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 3 (as WB positive control) 100 ug
$665.00
TP304603 Recombinant protein of human transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha) (TFAP2A), transcript variant 2, 20 µg
20 ug
$867.00

View other "AP2 alpha or NM_003220" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TFAP2A antibody: synthetic peptide directed towards the C terminal of human TFAP2A. Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 48 kDa
Gene Name transcription factor AP-2 alpha
Database Link
Background TFAP2A is a sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limbs and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2 alpha is the only AP-2 protein required for early morphogenesis of the lens vesicleAP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters. supplied by OMIM
Synonyms AP-2; AP-2alpha; AP2TF; BOFS; TFAP2
Note Immunogen sequence homology: Human: 100%; Dog: 92%; Guinea pig: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Chicken: 85%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products