OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ADAR1 (ADAR) (NM_001025107) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319761M
Recombinant protein of human adenosine deaminase, RNA-specific (ADAR), transcript variant 4, 100 µg
Size:
100 ug 20 ug 1 mg
  $2,950.00
5 Days*
Bulk/Customize

Frequently Bought Together (2)

TA308833 Rabbit polyclonal antibody to Adenosine Deaminase (adenosine deaminase, RNA-specific)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ADAR1 or NM_001025107"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219761 protein sequence
Red=Cloning site Green=Tags(s)

MAEIKEKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKRERMQI
KRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLENRQEARPEPARLKPP
VHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPI
SGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKA
KDSGKSEESSHYSTEKESEKTAESQTPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPK
FQYCVAVGAQTFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRK
IGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAA
DAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTL
TNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYS
ELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFENP
KQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSV
TLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYD
LEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKD
MGYGNWISKPQEEKNFYLCPV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 103.5 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001020278
Locus ID 103
UniProt ID P55265
Cytogenetics 1q21.3
RefSeq Size 6532
RefSeq ORF 2793
Synonyms ADAR1; AGS6; DRADA; DSH; DSRAD; G1P1; IFI-4; IFI4; K88DSRBP; P136
Summary This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double-stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2010
Protein Categories Immune system diseases, Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Cytosolic DNA-sensing pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

A conserved long-range RNA interaction in SARS-CoV-2 recruits ADAR1 to enhance virus proliferation
Yang, DeFalco, Wang et al
bioRxiv (2025)
AI Summary: OriGene’s recombinant ADAR1 protein (TP319761M) was used in binding assays to investigate how SARS-CoV-2 RNA structures interact with ADAR1, helping to show that this interaction enhances viral proliferation.
Snippet: 467 The assay was performed using agarose gel as previously described39 with some 468 modifications. Twenty five nanomole of folded RNA was incubated with increasing 469 concentration (0 to 1.25 μM) of ADAR1 protein (TP319761M, Origene), SARS-CoV-2 470 nucleocapsid (N)
A multicellular star-shaped actin network underpins epithelial organization and connectivity
Barai, Soleilhac, Xi et al
Nat Commun (2025) 16 (1), 6201 DOI: 10.1038/s41467-025-61438-1
Cited by 13
AI Summary: In this study, OriGene's ADAR1 protein (TP319761M) was used in binding assays to investigate molecular interactions relevant to the organization and stability of epithelial actin networks.
Snippet: 467 The assay was performed using agarose gel as previously described39 with some 468 modifications. Twenty five nanomole of folded RNA was incubated with increasing 469 concentration (0 to 1.25 μM) of ADAR1 protein (TP319761M, Origene), SARS-CoV-2 470 nucleocapsid (N)
FigureFigureFigure
High-speed atomic force microscopy and 3D modeling reveal the structural dynamics of ADAR1 complexes
Biyani, Isogai, Sharma et al
Nat Commun (2025) 16 (1), 4757 DOI: 10.1038/s41467-025-59987-6
Cited by 3
AI Summary: OriGene's Human Recombinant ADAR Protein (NM_001025107) was used in this study to investigate the structural dynamics and oligomerization of ADAR1 complexes, enabling detailed analysis of its interactions and function.
Snippet: ion may, therefore, be a valuable addition to therapeutic approaches for diseases associated with aberrant RNA editing. MethodsMaterials Human Recombinant ADAR Protein NM_001025107 was purchased from OriGene (Rockville, MD, USA). StriptMAX Thermo T7 Transcription Kit and ReverTra Ace were purchased from Toyobo (Japan). NucleoSpin Gel and PCR Clean-up Kit, Gflex DNA polymerase, DNase I, and RNa
FigureFigureFigure
AKT-dependent phosphorylation of the adenosine deaminases ADAR-1 and -2 inhibits deaminase activity
Bavelloni, Focaccia, Piazzi et al
FASEB J. (2019)
AI Summary: OriGene’s recombinant human ADAR1p110 protein (TP319761) was used in in vitro kinase assays to investigate AKT-mediated phosphorylation and its inhibitory effect on ADAR deaminase activity in this study.
Snippet: … THE JOURNAL • RESEARCH • www.fasebj.org AKT-dependent phosphorylation of the adenosine deaminases ADAR-1 and -2 inhibits deaminase activity Alberto Bavelloni,*,1 Enrico Focaccia,*, ,1 Manuela Piazzi,*, ,1 Mirco Raffini,* Valeriana Cesarini, ‡;Recombinant human (rh) AKT1 (A16-10G), AKT2 (A17-10G), or AKT3 (A18-10G) (0.5 mg, rhAKT;SignalChem, Richmond, BC, Canada) was used to phosphorylate rhADAR1p110 (0.5 mg, TP319761;Origene Technologies, Rockville, MD, USA) or rhADAR2 (0.5 mg, H00000104-P01;Abnova, Taipei, Taiwan) in an in vitro AKT kinase reaction containing 20 mM Tris-HCl, pH 7.5, 10 mM MgCl2, 10 mM MnCl2, 1 mM DTT, 200mM ATP, and 5 mCi g-[32P]-ATP (or alternatively in the absence of g-[32P]- ATP, 400 mM ATP) for 2 h at 30°C
The double-domain cytidine deaminase APOBEC3G is a cellular site-specific RNA editing enzyme
Sharma, Patnaik, Taggart et al
Sci Rep (2016) 6, 39100 DOI: 10.1038/srep39100
AI Summary: OriGene contributed to this study by providing the full-length Myc-DDK tagged wild-type APOBEC3G protein, which was used to investigate APOBEC3G's RNA editing activity.
Snippet: Unlike A3A 30 , we were unable to express the full length WT A3G protein in E. coli . Therefore, we purchased full length Myc-DDK tagged WT A3G protein from Origene (Rockville, MD) that was expressed in 293T cells and purified via affin- ity chromatography on anti-DDK column (Fig. 3a)
FigureFigureFigure
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products