ADAR1 (ADAR) (NM_001025107) Human Recombinant Protein

  • MVPro

    Full-length human proteins expressed in HEK293T cells

SKU
TP319761
Recombinant protein of human adenosine deaminase, RNA-specific (ADAR), transcript variant 4, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219761 protein sequence
Red=Cloning site Green=Tags(s)

MAEIKEKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKRERMQI
KRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLENRQEARPEPARLKPP
VHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPI
SGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKA
KDSGKSEESSHYSTEKESEKTAESQTPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPK
FQYCVAVGAQTFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRK
IGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAA
DAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTL
TNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYS
ELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFENP
KQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSV
TLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYD
LEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKD
MGYGNWISKPQEEKNFYLCPV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 103.5 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001020278
Locus ID 103
UniProt ID P55265
Cytogenetics 1q21.3
RefSeq Size 6532
RefSeq ORF 2793
Synonyms ADAR1; AGS6; DRADA; DSH; DSRAD; G1P1; IFI-4; IFI4; K88DSRBP; P136
Summary This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double-stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2010]
Protein Families Druggable Genome
Protein Pathways Cytosolic DNA-sensing pathway
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
PH319761 ADAR MS Standard C13 and N15-labeled recombinant protein (NP_001020278) 10 ug
$3,255.00
LC414369 ADAR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420128 ADAR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422591 ADAR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425483 ADAR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414369 Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 3 100 ug
$665.00
LY420128 Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 1 100 ug
$436.00
LY422591 Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 4 100 ug
$665.00
LY425483 Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 4 100 ug
$665.00
TP762358 Purified recombinant protein of Human adenosine deaminase, RNA-specific (ADAR), transcript variant 4, Thr30-Gln360, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.