ADAR1 (ADAR) (NM_001025107) Human Mass Spec Standard

SKU
PH319761
ADAR MS Standard C13 and N15-labeled recombinant protein (NP_001020278)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219761]
Predicted MW 103.6 kDa
Protein Sequence
Protein Sequence
>RC219761 protein sequence
Red=Cloning site Green=Tags(s)

MAEIKEKICDYLFNVSDSSALNLAKNIGLTKARDINAVLIDMERQGDVYRQGTTPPIWHLTDKKRERMQI
KRNTNSVPETAPAAIPETKRNAEFLTCNIPTSNASNNMVTTEKVENGQEPVIKLENRQEARPEPARLKPP
VHYNGPSKAGYVDFENGQWATDDIPDDLNSIRAAPGEFRAIMEMPSFYSHGLPRCSPYKKLTECQLKNPI
SGLLEYAQFASQTCEFNMIEQSGPPHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAMKAMTILLEEAKA
KDSGKSEESSHYSTEKESEKTAESQTPTPSATSFFSGKSPVTTLLECMHKLGNSCEFRLLSKEGPAHEPK
FQYCVAVGAQTFPSVSAPSKKVAKQMAAEEAMKALHGEATNSMASDNQPEGMISESLDNLESMMPNKVRK
IGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAA
DAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEAQPKTLPLTGSTFHDQIAMLSHRCFNTL
TNSFQPSLLGRKILAAIIMKKDSEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYS
ELMKYNSQTAKDSIFEPAKGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAMESTESRHYPVFENP
KQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPIYLKSV
TLGYLFSQGHLTRAICCRVTRDGSAFEDGLRHPFIVNHPKVGRVSIYDSKRQSGKTKETSVNWCLADGYD
LEILDGTRGTVDGPRNELSRVSKKNIFLLFKKLCSFRYRRDLLRLSYGEAKKAARDYETAKNYFKKGLKD
MGYGNWISKPQEEKNFYLCPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001020278
RefSeq Size 6532
RefSeq ORF 2793
Synonyms ADAR1; AGS6; DRADA; DSH; DSRAD; G1P1; IFI-4; IFI4; K88DSRBP; P136
Locus ID 103
UniProt ID P55265
Cytogenetics 1q21.3
Summary This gene encodes the enzyme responsible for RNA editing by site-specific deamination of adenosines. This enzyme destabilizes double-stranded RNA through conversion of adenosine to inosine. Mutations in this gene have been associated with dyschromatosis symmetrica hereditaria. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2010]
Protein Families Druggable Genome
Protein Pathways Cytosolic DNA-sensing pathway
Write Your Own Review
You're reviewing:ADAR1 (ADAR) (NM_001025107) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414369 ADAR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420128 ADAR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422591 ADAR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425483 ADAR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY414369 Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 3 100 ug
$665.00
LY420128 Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 1 100 ug
$436.00
LY422591 Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 4 100 ug
$665.00
LY425483 Transient overexpression lysate of adenosine deaminase, RNA-specific (ADAR), transcript variant 4 100 ug
$665.00
TP319761 Recombinant protein of human adenosine deaminase, RNA-specific (ADAR), transcript variant 4, 20 µg 20 ug
$867.00
TP762358 Purified recombinant protein of Human adenosine deaminase, RNA-specific (ADAR), transcript variant 4, Thr30-Gln360, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.