OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UCP1 (NM_021833) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC218901
UCP1 (Myc-DDK-tagged)-Human uncoupling protein 1 (mitochondrial, proton carrier) (UCP1), nuclear gene encoding mitochondrial protein
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $300.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA383061 UCP1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "UCP1 or NM_021833"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UCP1
Synonyms SLC25A7; UCP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218901 representing NM_021833
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGGCCTGACAGCCTCGGACGTACACCCGACCCTGGGGGTCCAGCTCTTCTCAGCTGGAATAGCGG
CGTGCTTGGCGGACGTGATCACCTTCCCGCTGGACACGGCCAAAGTCCGGCTCCAGGTCCAAGGTGAATG
CCCGACGTCCAGTGTTATTAGGTATAAAGGTGTCCTGGGAACAATCACCGCTGTGGTAAAAACAGAAGGG
CGGATGAAACTCTACAGCGGGCTGCCTGCGGGGCTTCAGCGGCAAATCAGCTCCGCCTCTCTCAGGATCG
GCCTCTACGACACGGTCCAGGAGTTCCTCACCGCAGGGAAAGAAACAGCACCTAGTTTAGGAAGCAAGAT
TTTAGCTGGTCTAACGACTGGAGGAGTGGCAGTATTCATTGGGCAACCCACAGAGGTCGTGAAAGTCAGA
CTTCAAGCACAGAGCCATCTCCACGGAATCAAACCTCGCTACACGGGGACTTATAATGCGTACAGAATAA
TAGCAACAACCGAAGGCTTGACGGGTCTTTGGAAAGGGACTACTCCCAATCTGATGAGAAGTGTCATCAT
CAATTGTACAGAGCTAGTAACATATGATCTAATGAAGGAGGCCTTTGTGAAAAACAACATATTAGCAGAT
GACGTCCCCTGCCACTTGGTGTCGGCTCTTATCGCTGGATTTTGCGCAACAGCTATGTCCTCCCCGGTGG
ATGTAGTAAAAACCAGATTTATTAATTCTCCACCAGGACAGTACAAAAGTGTGCCCAACTGTGCAATGAA
AGTGTTCACTAACGAAGGACCAACGGCTTTCTTCAAGGGGTTGGTACCTTCCTTCTTGCGACTTGGATCC
TGGAACGTCATTATGTTTGTGTGCTTTGAACAACTGAAACGAGAACTGTCAAAGTCAAGGCAGACTATGG
ACTGTGCCACA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC218901 representing NM_021833
Red=Cloning site Green=Tags(s)

MGGLTASDVHPTLGVQLFSAGIAACLADVITFPLDTAKVRLQVQGECPTSSVIRYKGVLGTITAVVKTEG
RMKLYSGLPAGLQRQISSASLRIGLYDTVQEFLTAGKETAPSLGSKILAGLTTGGVAVFIGQPTEVVKVR
LQAQSHLHGIKPRYTGTYNAYRIIATTEGLTGLWKGTTPNLMRSVIINCTELVTYDLMKEAFVKNNILAD
DVPCHLVSALIAGFCATAMSSPVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAFFKGLVPSFLRLGS
WNVIMFVCFEQLKRELSKSRQTMDCAT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_021833
ORF Size 921 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021833.5
RefSeq Size 1047 bp
RefSeq ORF 924 bp
Locus ID 7350
UniProt ID P25874
Cytogenetics 4q31.1
Protein Families Druggable Genome
Protein Pathways Huntington's disease, PPAR signaling pathway
MW 32.8 kDa
Summary Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_021833" in other vectors (6)
SKU Description Size Price
RC218901L1 Lenti ORF clone of Human uncoupling protein 1 (mitochondrial, proton carrier) (UCP1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC218901L2 Lenti ORF clone of Human uncoupling protein 1 (mitochondrial, proton carrier) (UCP1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC218901L3 Lenti ORF clone of Human uncoupling protein 1 (mitochondrial, proton carrier) (UCP1), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC218901L4 Lenti ORF clone of Human uncoupling protein 1 (mitochondrial, proton carrier) (UCP1), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RG218901 UCP1 (tGFP-tagged) - Human uncoupling protein 1 (mitochondrial, proton carrier) (UCP1), nuclear gene encoding mitochondrial protein 10 ug
$489.00 $500.00
SC304965 UCP1 (untagged)-Human uncoupling protein 1 (mitochondrial, proton carrier) (UCP1), nuclear gene encoding mitochondrial protein 10 ug
$450.00

Plasmid Map for RC218901

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC218901
Circular map for RC218901

file-alt Citations

TRIB2 couples UCP1 degradation to thermogenic adaptation and metabolic health
Lee, Chueh, Tien et al
bioRxiv (2025)
AI Summary: OriGene’s UCP1 Human tagged ORF clone (Cat# RC218901) was used in this study to generate constructs for investigating the molecular mechanisms by which TRIB2 regulates UCP1 degradation and thermogenic adaptation.
Snippet: ) A were digested by HindIII-HF (#R3014S) and XhoI (#R0146S) enzymes using NEB buffer rCutsmart (NB6004S). UCP1 Human tagged ORF clone (#RC218901) was purchased from OriGene Technologies and subcloned into EcoRI (#R3101S) and XmaI (#R0180S) sites of pLV-C-GFPSpark Lentivirus vector (#LVCV-35)
Implantation of engineered adipocytes suppresses tumor progression in cancer models
Nguyen, An, Ito et al
Nat Biotechnol (2025)
Cited by 45
AI Summary: OriGene’s FLAG-tagged human UCP1 plasmid (RC218901) was used to generate UCP1-positive control adipocytes, enabling the study to demonstrate that engineered adipocytes with enhanced nutrient utilization can suppress tumor progression.
Snippet: To generate a UCP1-positive control, 2 µg of a FLAG-tagged human UCP1 plasmid (Origene, RC218901) was mixed with 200 µl of Opti-MEM (Fisher Scientific, 31985062) and 4 µl of X-tremeGENE HP DNA Transfection Reagent (Roche, XTGHP-RO) and incubated for 15 min. The mixture was added onto AAVpro 293T cells (Takara, 632273) at 6 × 105 pe
A Novel Endocrine Role the BAT-Released Lipokine 12,13-diHOME to Mediate Cardiac Function
Pinckard, Shettigar, Wright et al
Circulation (2020)
AI Summary: OriGene products contributed to this study by providing the UCP1, Ephx1, and Ephx2 plasmids, which were used for tissue nanotransfection experiments to investigate the endocrine role of BAT and the effects of 12,13-diHOME on cardiac function.
Snippet: … All plasmids (UCP1, Ephx1, Ephx2) were purchased from Origene and expanded in Escherichia coli following standard procedures. … All plasmids (UCP1, Ephx1, Ephx2) were purchased from Origene and expanded in Escherichia coli following standard procedures. …
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products