OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PCLAF (NM_014736) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200694
KIAA0101 (Myc-DDK-tagged)-Human KIAA0101 (KIAA0101), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA366344 PCLAF rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PCLAF or NM_014736"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PCLAF
Synonyms KIAA0101; L5; NS5ATP9; OEATC; OEATC-1; OEATC1; p15(PAF); p15/PAF; p15PAF; PAF; PAF15
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200694 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGCGGACTAAAGCAGACAGTGTTCCAGGCACTTACAGAAAAGTGGTGGCTGCTCGAGCCCCCAGAA
AGGTGCTTGGTTCTTCCACCTCTGCCACTAATTCGACATCAGTTTCATCGAGGAAAGCTGAAAATAAATA
TGCAGGAGGGAACCCCGTTTGCGTGCGCCCAACTCCCAAGTGGCAAAAAGGAATTGGAGAATTCTTTAGG
TTGTCCCCTAAAGATTCTGAAAAAGAGAATCAGATTCCTGAAGAGGCAGGAAGCAGTGGCTTAGGAAAAG
CAAAGAGAAAAGCATGTCCTTTGCAACCTGATCACACAAATGATGAAAAAGAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200694 protein sequence
Red=Cloning site Green=Tags(s)

MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR
LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE

TRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014736
ORF Size 333 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014736.6
RefSeq Size 1515 bp
RefSeq ORF 336 bp
Locus ID 9768
UniProt ID Q15004
Cytogenetics 15q22.31
Protein Families Druggable Genome
MW 12 kDa
Summary PCNA-binding protein that acts as a regulator of DNA repair during DNA replication. Following DNA damage, the interaction with PCNA is disrupted, facilitating the interaction between monoubiquitinated PCNA and the translesion DNA synthesis DNA polymerase eta (POLH) at stalled replisomes, facilitating the bypass of replication-fork-blocking lesions. Also acts as a regulator of centrosome number.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014736" in other vectors (4)
SKU Description Size Price
RC200694L3 Lenti ORF clone of Human KIAA0101 (KIAA0101), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC200694L4 Lenti ORF clone of Human KIAA0101 (KIAA0101), transcript variant 1, mGFP tagged 10 ug
$450.00
RG200694 KIAA0101 (tGFP-tagged) - Human KIAA0101 (KIAA0101), transcript variant 1 10 ug
$350.00
SC114891 KIAA0101 (untagged)-Human KIAA0101 (KIAA0101), transcript variant 1 10 ug
$150.00

Plasmid Map for RC200694

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200694
Circular map for RC200694

file-alt Citations

PAF15-PCNA exhaustion governs the strand-specific control of DNA replication
Chhetri, Badugu, Petriman et al
Nature (2026)
Cited by 10
AI Summary: OriGene’s PAF15wt-1×MYC-1×-Flag-tag plasmid (RC200694) was used in complementation assays to express wild-type PAF15 in PAF15 knockout cells, enabling the study of PAF15’s role in regulating DNA replication and PCNA function.
Snippet: For complementation assays with constitutive expression, PAF15-KO U2OS cell lines were transfected with the following variant plasmids: PAF15wt-1×MYC-1×-Flag-tag (Origene, RC200694), PAF15 PIP-box mutant (F68F69 to AA mutation)-1×Flag or PAF15 KEN-box mutant (K78A mutation)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products