OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KBTBD10 (KLHL41) (NM_006063) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC200295
KLHL41 (Myc-DDK-tagged)-Human kelch repeat and BTB (POZ) domain containing 10 (KBTBD10)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $564.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA343578 Rabbit Polyclonal Anti-KBTBD10 Antibody
100 ul
$525.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "KBTBD10 or NM_006063"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KBTBD10
Synonyms KBTBD10; Krp1; SARCOSIN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC200295 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTCCCAGCGGGAACTTGCAGAGGAACTGCGGCTTTACCAATCCACCCTTCTTCAGGATGGTCTAA
AAGATCTCCTGGATGAGAAAAAATTCATCGATTGCACCCTAAAAGCAGGTGACAAAAGTCTTCCTTGCCA
CAGATTGATTTTGTCAGCTTGTAGTCCTTACTTCCGTGAGTACTTTTTATCTGAAATTGATGAGGCGAAA
AAAAAGGAGGTAGTGCTAGACAATGTGGATCCTGCTATACTTGATTTAATCATCAAATACCTGTACTCTG
CCAGTATTGATCTCAATGACGGAAATGTGCAAGATATTTTTGCATTGGCCAGCCGCTTTCAGATCCCCTC
AGTGTTTACTGTCTGCGTTTCTTATCTTCAGAAAAGACTTGCTCCTGGTAACTGTCTAGCCATCCTAAGA
TTAGGACTTCTTCTTGACTGCCCGAGACTCGCCATTTCTGCCCGTGAATTTGTGTCTGATCGCTTTGTAC
AGATTTGTAAGGAAGAGGACTTTATGCAACTGTCTCCACAGGAACTGATCTCAGTCATTTCAAATGACAG
CCTAAATGTAGAAAAAGAAGAAGCAGTATTTGAGGCAGTGATGAAATGGGTGCGAACAGACAAGGAAAAC
AGGGTTAAAAACCTTAGTGAAGTGTTTGATTGTATCCGTTTTCGCCTTATGACAGAAAAATATTTTAAGG
ATCATGTTGAGAAAGATGATATAATTAAAAGCAACCCAGACCTCCAGAAAAAAATCAAAGTTCTAAAAGA
TGCTTTCGCAGGCAAACTCCCAGAACCTAGCAAAAATGCCGCGAAGACTGGGGCTGGTGAGGTGAATGGT
GATGTTGGTGATGAAGATTTACTTCCTGGTTACCTGAATGACATTCCCAGGCATGGAATGTTTGTAAAAG
ACCTCATCCTCTTGGTTAATGACACAGCAGCAGTGGCTTATGACCCCACGGAAAATGAATGCTACCTTAC
TGCACTGGCTGAGCAGATTCCCAGAAATCATTCCAGCATTGTTACCCAGCAAAATCAGATATATGTGGTA
GGAGGACTATATGTGGATGAAGAAAATAAGGATCAACCTCTACAGTCATACTTCTTCCAGCTCGATAGCA
TAGCATCTGAATGGGTTGGACTTCCACCTCTGCCTTCAGCCAGGTGTCTCTTCGGTCTGGGAGAGGTGGA
TGATAAAATCTATGTAGTTGCAGGCAAAGACCTTCAAACAGAGGCTTCGCTGGATTCAGTATTATGCTAT
GATCCTGTGGCTGCAAAATGGAACGAAGTAAAAAAACTCCCTATCAAAGTCTATGGCCATAATGTGATTT
CACATAAAGGGATGATATATTGTCTAGGAGGAAAGACAGATGACAAAAAATGTACAAACAGGGTGTTTAT
CTTCAACCCCAAAAAAGGAGATTGGAAAGATCTGGCTCCAATGAAAATTCCTCGTTCCATGTTTGGAGTA
GCAGTCCATAAAGGCAAAATTGTGATTGCAGGAGGTGTCACTGAAGATGGTCTTTCAGCTTCAGTTGAAG
CTTTTGACCTTACAACAAATAAATGGGATGTAATGACCGAATTTCCCCAAGAAAGAAGCTCCATCAGTTT
GGTCAGCCTGGCTGGATCTCTGTATGCAATTGGTGGTTTTGCTATGATTCAACTGGAGTCTAAAGAATTT
GCACCCACTGAAGTCAATGACATATGGAAGTATGAAGATGATAAAAAAGAATGGGCTGGGATGTTGAAGG
AAATACGTTATGCTTCAGGAGCTAGTTGCCTAGCAACACGTTTAAATCTCTTCAAACTGTCTAAACTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC200295 protein sequence
Red=Cloning site Green=Tags(s)

MDSQRELAEELRLYQSTLLQDGLKDLLDEKKFIDCTLKAGDKSLPCHRLILSACSPYFREYFLSEIDEAK
KKEVVLDNVDPAILDLIIKYLYSASIDLNDGNVQDIFALASRFQIPSVFTVCVSYLQKRLAPGNCLAILR
LGLLLDCPRLAISAREFVSDRFVQICKEEDFMQLSPQELISVISNDSLNVEKEEAVFEAVMKWVRTDKEN
RVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNG
DVGDEDLLPGYLNDIPRHGMFVKDLILLVNDTAAVAYDPTENECYLTALAEQIPRNHSSIVTQQNQIYVV
GGLYVDEENKDQPLQSYFFQLDSIASEWVGLPPLPSARCLFGLGEVDDKIYVVAGKDLQTEASLDSVLCY
DPVAAKWNEVKKLPIKVYGHNVISHKGMIYCLGGKTDDKKCTNRVFIFNPKKGDWKDLAPMKIPRSMFGV
AVHKGKIVIAGGVTEDGLSASVEAFDLTTNKWDVMTEFPQERSSISLVSLAGSLYAIGGFAMIQLESKEF
APTEVNDIWKYEDDKKEWAGMLKEIRYASGASCLATRLNLFKLSKL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006063
ORF Size 1818 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006063.3
RefSeq Size 2472 bp
RefSeq ORF 1821 bp
Locus ID 10324
UniProt ID O60662
Cytogenetics 2q31.1
Domains Kelch
MW 68 kDa
Summary This gene is a member of the kelch-like family. The encoded protein contains a BACK domain, a BTB/POZ domain, and 5 Kelch repeats. This protein is thought to function in skeletal muscle development and maintenance. Mutations in this gene have been associated with nemaline myopathy (NM), a rare congenital muscle disorder. provided by RefSeq, Mar 2015
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006063" in other vectors (5)
SKU Description Size Price
RC200295L3 Lenti ORF clone of Human kelch repeat and BTB (POZ) domain containing 10 (KBTBD10), Myc-DDK-tagged 10 ug
$864.00
RC200295L4 Lenti ORF clone of Human kelch repeat and BTB (POZ) domain containing 10 (KBTBD10), mGFP tagged 10 ug
$864.00
RG200295 KLHL41 (tGFP-tagged) - Human kelch repeat and BTB (POZ) domain containing 10 (KBTBD10) 10 ug
$764.00
SC111146 KLHL41 (untagged)-Human kelch repeat and BTB (POZ) domain containing 10 (KBTBD10) 10 ug
$565.00
SC320845 KLHL41 (untagged)-Human kelch repeat and BTB (POZ) domain containing 10 (KBTBD10) 10 ug
$565.00

Plasmid Map for RC200295

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC200295
Circular map for RC200295

file-alt Citations

Discovery of a KLHL41 Ligand for Muscle Specific Protein Degradation
Yim, Lee, Kim et al
Nat Commun (2026) 17 (1) DOI: 10.1038/s41467-026-73252-4
Cited by 2
AI Summary: OriGene’s hKLHL41 plasmid (RC200295) was used in this study to overexpress KLHL41 in cells, enabling the researchers to investigate the role of KLHL41 in muscle-specific protein degradation.
Snippet: UCLEOTIDE SEQUENCES FOR KLHL41 ARE AS FOLLOWS siKLHL41 sense 5′- CUG AUC GCU UUG UAC AGA U TT -3′ antisense 5′- AUC UGU ACA AAG CGA UCA G TT -3′ KLHL41 OVEREXPRESSION The hKLHL41 plasmid (Origene;RC200295) and hKLHL41 C593S plasmid (Cloned by Cosmogenetech via overlap PCR method) were transiently transfected into HeLa cells using Lipofectamine LTX Plus (Invitrogen;#15338-100) and Opt;CUG AUC GCU UUG UAC AGA U TT -3′antisense 5′- AUC UGU ACA AAG CGA UCA G TT -3′KLHL41 overexpressionThe hKLHL41 plasmid (Origene
FigureFigureFigure
KLHL12 can form large COPII structures in the absence of CUL3 neddylation
Moretti, Kim, Tuladhar et al
Mol Biol Cell (2023) 34 (3), br4 DOI: 10.1091/mbc.E22-08-0383
AI Summary: OriGene products, specifically pCMV6-Entry (PS100001), human pCMV6-KLHL40-Myc-DDK (RC213832), and human pCMV6-KLHL41-Myc-DDK (RC200295), were used as plasmid controls and expression constructs to support mutagenesis and functional studies of KLHL12 in the investigation of COPII structure formation and collagen secretion.
Snippet: e-directed mutagenesis (Supplemental Figure S2 and Supplemental Table S1). pCMV6-Entry (PS100001), human pCMV6-KLHL40-Myc-DDK (RC213832), and human pCMV6-KLHL41-Myc-DDK (RC200295) were purchased from Origene (Rockville, MD). The pLVX-TRE3G and pLVX-Tet3G constructs used to clone KLHL12 were purchase from Takara Bio USA as part of the In-Fusion HD Cloning Kit (121416). The controls (D-001206-13) we
FigureFigureFigure
Cullin3-RING ubiquitin ligases are intimately linked to the unfolded protein response of the endoplasmic reticulum
Kim, Park, Kim
bioRxiv (2018)
Snippet: by site-directed mutagenesis (Fig. S1 and Table S1). pCMV6-Entry (PS100001), human pCMV6-KLHL40-Myc-DDK (RC213832), and human pCMV6-KLHL41-Myc-DDK (RC200295) were purchased from Origene (Rockville, MD, USA). The control (D-01910-10 View as HTML
Identifying novel peroxisome-associated proteins in mouse liver and pig heart by implementing different quantitative proteomics approaches
Thesis (2024)
Snippet: KLHL41 (RC200295), SAR1B (MR201981), PDCD6 (MR222510), OCIAD1 (MR219053), HTATIP2 (MC200905) and PAFAH2 (MC201744) constructs were purchased from OriGene (Rockville, USA)
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products