PDCD10 (NM_007217) Human Recombinant Protein

CAT#: TP720886

Reviews ()
Write a review

Purified recombinant protein of Human programmed cell death 10 (PDCD10), transcript variant 1


 Product Datasheet for 'TP720886'

  View other "PDCD10" proteins (12)

USD 299.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human programmed cell death 10 (PDCD10), transcript variant 1
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence GSHMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Tag Tag Free
Predicted MW 24.9 kDa
Concentration lot specific
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Supplied as 0.2 µM filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4
Endotoxin Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Reference Data
RefSeq NP_009148
Locus ID 11235
Refseq Size 1454
Cytogenetics 3q26.1
Refseq ORF 636
Synonyms CCM3; TFAR15
Summary This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome

Documents

Other Versions

Other products for "PDCD10"
Frequently bought together (1)
Anti-PDCD10 Rabbit Polyclonal Antibody
    • 100 ul

USD 335.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones
HUMAN PROREINS 101