OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PDCD10 (NM_007217) Human Mass Spec Standard

Be the first to review this product
SKU
PH300235
PDCD10 MS Standard C13 and N15-labeled recombinant protein (NP_009148)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY416120 Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "PDCD10 or NM_007217"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200235
Predicted MW 24.7 kDa
Protein Sequence
Protein Sequence
>RC200235 protein sequence
Red=Cloning site Green=Tags(s)

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK
SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE
LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT
VA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009148
RefSeq Size 1454
RefSeq ORF 636
Synonyms CCM3; TFAR15
Locus ID 11235
UniProt ID Q9BUL8
Cytogenetics 3q26.1
Summary This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. provided by RefSeq, Jul 2008
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PDCD10" proteins (8)
SKU Description Size Price
LC407854 Lyophilized PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC407855 Lyophilized PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC416120 Lyophilized PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY407854 Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY407855 Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY416120 Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP300235 Recombinant protein of human programmed cell death 10 (PDCD10), transcript variant 1, 20 µg 20 ug
$737.00
TP720886 Purified recombinant protein of Human programmed cell death 10 (PDCD10), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products