CD79B (NM_001039933) Human Recombinant Protein

CAT#: TP720747

Reviews ()
Write a review

Purified recombinant protein of Human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3



  View other "CD79B" proteins (6)

USD 300.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDVDHHHHHH
Tag C-His
Predicted MW 16.25 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_001035022
Locus ID 974
Refseq Size 1303
Cytogenetics 17q23.3
Refseq ORF 1428
Synonyms AGM6; B29; IGB
Summary The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways B cell receptor signaling pathway

Documents

Other Versions

Other products for "CD79B"
Frequently bought together (1)
CD79B mouse monoclonal antibody,clone OTI8A12
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101