CD79B (NM_001039933) Human Recombinant Protein

SKU
TP300665
Recombinant protein of human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200665 representing NM_001039933
Red=Cloning site Green=Tags(s)

MARLALSPVPSHWMVALLLLLSAEPVPAARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSA
SGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTEL
RVMGFSTLAQLKQRNTLKDGIIMIQTLLIILFIIVPIFLLLDKDDSKAGMEEDHTYEGLDIDQTATYEDI
VTLRTGEVKWSVGEHPGQE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 23.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001035022
Locus ID 974
UniProt ID P40259
Cytogenetics 17q23.3
RefSeq Size 1303
RefSeq ORF 687
Synonyms AGM6; B29; IGB
Summary The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig). Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transmembrane
Protein Pathways B cell receptor signaling pathway
Write Your Own Review
You're reviewing:CD79B (NM_001039933) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300665 CD79B MS Standard C13 and N15-labeled recombinant protein (NP_001035022) 10 ug
$3,255.00
LC421857 CD79B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424598 CD79B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421857 Transient overexpression lysate of CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3 100 ug
$436.00
LY424598 Transient overexpression lysate of CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 1 100 ug
$436.00
TP720747 Purified recombinant protein of Human CD79b molecule, immunoglobulin-associated beta (CD79B), transcript variant 3 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.