Cd80 (NM_009855) Mouse Recombinant Protein

CAT#: TP527446

Purified recombinant protein of Mouse CD80 antigen (Cd80), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227446 representing NM_009855
  Red=Cloning site Green=Tags(s)
  
  MACNCQLMQDTPLLKFPCPRLILLFVLLIRLSQVSSDVDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYW
  QKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLS
  IKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFN
  TTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNTLVLFGAGFGAVITVVVIVVIIKCFCKHRSCFRR
  RNEASRETNNSLTFGPEEALAEQTVFL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 35 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_033985
• Locus ID: 12519
• UniProt ID: Q00609, Q549R2
• Cytogenetics: 16 26.86 cM
• Refseq Size: 1701
• Refseq ORF: 921
• Synonyms: B71; Cd28l; Ly-53; Ly53; MIC17; TSA1
• Summary: Involved in the costimulatory signal essential for T lymphocytes activation. T-cell proliferation and cytokine production is induced by the binding of CD28 or CTLA-4 to this receptor.[UniProtKB/Swiss-Prot Function]