OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Foxp3 (NM_054039) Mouse Recombinant Protein

Be the first to review this product
SKU
TP527205
Purified recombinant protein of Mouse forkhead box P3 (Foxp3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA329970 Rabbit Polyclonal Anti-Foxp3 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Foxp3 or NM_054039"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR227205 representing NM_054039
Red=Cloning site Green=Tags(s)

MPNPRPAKPMAPSLALGPSPGVLPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQL
PTVPLVMVAPSGARLGPSPHLQALLQDRPHFMHQLSTVDAHAQTPVLQVRPLDNPAMISLPPPSAATGVF
SLKARPGLPPGINVASLEWVSREPALLCTFPRSGTPRKDSNLLAAPQGSYPLLANGVCKWPGCEKVFEEP
EEFLKHCQADHLLDEKGKAQCLLQREVVQSLEQQLELEKEKLGAMQAHLAGKMALAKAPSVASMDKSSCC
IVATSTQGSVLPAWSAPREAPDGGLFAVRRHLWGSHGNSSFPEFFHNMDYFKYHNMRPPFTYATLIRWAI
LEAPERQRTLNEIYHWFTRMFAYFRNHPATWKNAIRHNLSLHKCFVRVESEKGAVWTVDEFEFRKKRSQR
PNKCSNPCP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 47.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_473380
Locus ID 20371
UniProt ID Q99JB6
Cytogenetics X 3.41 cM
RefSeq Size 3739
RefSeq ORF 1287
Synonyms JM2; scu; scurfin; sf
Summary The protein encoded by this gene is a member of the forkhead/winged-helix family of transcriptional regulators. Defects in this gene result in the scurfy phenotype (sf). Alternative splicing results in multiple transcript variants. provided by RefSeq, Sep 2015
Protein Categories ADC Targets, Cytokines, Diabetes, Growth Factors, Immune system diseases, Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Functional characterization of Foxp3-specific spontaneous immune responses
Larsen, Munir, Woetmann et al
Leukemia (2013)
Cited by 25
AI Summary: OriGene's recombinant Foxp3 protein was used to pulse dendritic cells, enabling the study of how Foxp3-specific cytotoxic T cells recognize and respond to Foxp3-expressing cells in this research on immune regulation.
Snippet: the enzyme substrate nitro-blue tetrazolium chloride/5-bromo-4-chloro-3'-indolyphosphate p-toluidine salt (Invitrogen Life Technologies) was ... Mature autologous dendritic cells (DC) were incubated overnight with or without Foxp3 protein (20 μg) (OriGene, Rockville, MD, USA
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products