Foxp3 Rabbit Polyclonal Antibody
Specifications
| Product Data | |
| Application | WB |
|---|---|
| Recommended Dilution | WB |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for Anti-Foxp3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Foxp3. Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 47 kDa |
| Gene Name | forkhead box P3 |
| Database Link | |
| Background | Foxp3 is a probable transcription factor. It plays a critical role in the control of immune response. |
| Synonyms | AIID; DIETER; FOXP3delta7; IPEX; JM2; MGC141961; MGC141963; PIDX; SCURFIN; XPID |
| Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 79% |
| Reference Data | |
| Protein Categories | ADC Targets, Cytokines, Diabetes, Growth Factors, Immune system diseases, Intracellular Proteins, Transciption Factors |
Reviews
Documents
| Product Manuals |
| FAQs |
| SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.