Foxp3 Rabbit Polyclonal Antibody

SKU TA329970

Rabbit Polyclonal Anti-Foxp3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Foxp3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Foxp3. Synthetic peptide located within the following region: LPSWKTAPKGSELLGTRGSGGPFQGRDLRSGAHTSSSLNPLPPSQLQLPT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 47 kDa
• Gene Name: forkhead box P3
• Database Link:
  NP_473380
  Q99JB6
• Background: Foxp3 is a probable transcription factor. It plays a critical role in the control of immune response.
• Synonyms: AIID; DIETER; FOXP3delta7; IPEX; JM2; MGC141961; MGC141963; PIDX; SCURFIN; XPID
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 79%

Reference Data