Nudt19 (NM_033080) Mouse Recombinant Protein

CAT#: TP524694

Purified recombinant protein of Mouse nudix (nucleoside diphosphate linked moiety X)-type motif 19 (Nudt19), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR224694 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSSSSWRRAATVMLAAGWTHSSPAGFRLLLLQRAQNQRFLPGAHVFPGGVLDAADSSPDWVRLFAPRHT
  PPRFGLGPEPPRQPPFPGLSHGDADPAALPDDVALRICAIREAFEEAGVLLLRPRDAAPASQEPSQALSP
  PAGLAEWRSRVRSDPRCFLQLCAHLDCTPDIWALHDWGGWLTPYGRTIRRFDTTFFLCCLRDIPRVEPDV
  AEVVGYQWLSPSEATECFLSKEIWLAPPQFYEMRRLENFASLSALYRFCSDRPSEVPEKWLPIILLTSDG
  TIHLLPGDELYVKDSDFLEKNMSTDKKTEEIVKEGKVLNRVVIHSPYVYEIYMTLPSENKHVYPRNYIVN
  KRCTAHL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 40.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_149071
• Locus ID: 110959
• UniProt ID: P11930
• Cytogenetics: 7 21.37 cM
• Refseq Size: 1927
• Refseq ORF: 1074
• Synonyms: D7Rp2; D7Rp2-r; D7Rp2-s; D7Rp2e; RP2-r; RP2-s
• Summary: Acyl-CoA diphosphatase that mediates the hydrolysis of a wide range of CoA esters, including choloyl-CoA and branched-chain fatty-acyl-CoA esters. At low substrate concentrations medium and long-chain fatty-acyl-CoA esters are the primary substrates.[UniProtKB/Swiss-Prot Function]