OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Csf2 (NM_009969) Mouse Recombinant Protein

Be the first to review this product
SKU
TP522594
Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA319463 Anti-GM-CSF (RABBIT) Antibody, 100 ug
100 ug
$870.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Csf2 or NM_009969"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR222594 representing NM_009969
Red=Cloning site Green=Tags(s)

MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQ
TRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQ
K

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 16.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_034099
Locus ID 12981
UniProt ID P01587
Cytogenetics 11 32.13 cM
RefSeq Size 1033
RefSeq ORF 423
Synonyms CSF; Csfgm; Gm-CSf; GMCSF; MGI-IGM
Summary Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.UniProtKB/Swiss-Prot Function
Protein Categories Cytokines, Growth Factors, Secreated Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Csf2" proteins (3)
SKU Description Size Price
TP723753 Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2) 10 ug
$345.00
TP723880 Purified recombinant protein of Rat GM-CSF (?) 10 ug
$345.00
TP750017 Recombinant protein of Mus musculus colony stimulating factor 2 (granulocyte-macrophage) (Csf2) produced in E. coli. 50 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products