Myh3 (NM_001099635) Mouse Recombinant Protein

CAT#: TP521574

Reviews ()
Write a review

Purified recombinant protein of Mouse myosin, heavy polypeptide 3, skeletal muscle, embryonic (Myh3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



USD 988.00

4 Weeks*

Size
    • 20 ug

Product images

Frequently bought together (1)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 412.00

Other products for "Myh3"

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221574 representing NM_001099635
Red=Cloning site Green=Tags(s)

MSSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYVKGKIKSSQDGKVTVETEDSRTL
VVKPEDVYAMNPPKFDKIEDMAMLTHLNEPAVLYNLKDRYTSWMIYTYSGLFCVTVNPYKWLPVYNPEVV
DGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAATGDLAKKKD
SKMKGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKA
ERSYHIFYQILSNKKPELIELLLITTNPYDYPFISQGEILVASIDDAEELLATDSAIDILGFTPEEKSGL
YKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKTAYLMGLNSSDLLKALCFPRVKVGNEYVTKGQTVDQ
VHHAVNALSKSVYEKLFLWMVTRINQQLDTKLPRQHFIGVLDIAGFEIFEYNSLEQLCINFTNEKLQQFF
NHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGK
SNNFQKPKVVKGKAEAHFSLVHYAGTVDYSVSGWLEKNKDPLNETVVGLYQKSSNRLLAHLYATFATTDA
DGGKKKVAKKKGSSFQTVSALFRENLNKLMSNLRTTHPHFVRCIIPNETKTPGAMEHSLVLHQLRCNGVL
EGIRICRKGFPNRILYGDFKQRYRVLNASAIPEGQFIDSKKACEKLLASIDIDHTQYKFGHTKVFFKAGL
LGTLEEMRDERLAKLITRTQAVCRGFLMRVEFQKMMQRRESIFCIQYNIRAFMNVKHWPWMKLFFKIKPL
LKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKLVTLVQEKNDLQLQVQAESENLLDAEERCDQLI
KAKFQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLT
EELAGLDETIAKLTREKKALQEAHQQTLDDLQAEEDKVNSLSKLKSKLEQQVDDLESSLEQEKKLRVDLE
RNKRKLEGDLKLAQESILDLENDKQQLDERLKKKDFEYSQLQSKVEDEQTLSLQLQKKIKELQARIEELE
EEIEAERATRAKTEKQRSDYARELEELSERLEEAGGVTSTQIELNKKREAEFLKLRRDLEEATLQHEATV
ATLRKKHADSAAELAEQIDNLQRVKQKLEKEKSEFKLEIDDLSSSVESVSKSKANLEKICRTLEDQLSEA
RGKNEEMQRSLSELTTQKSRLQTEAGELSRQLEEKESIVSQLSRSKQAFTQQIEELKRQLEEENKAKNAL
AHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQD
SEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVERANSLAAALDKKQRNFDKVLAEWKTKCEESQAELEA
ALKESRSLSTELFKLKNAYEEALDQLETVKRENKNLEQEIADLTEQIAENGKSIHELEKSRKQMELEKAD
IQMALEEAEAALEHEEAKILRIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTVETMQGALDAEVRSRN
EAIRLKKKMEGDLNEIEIQLSHANRQAAETIKHLRSVQGQLKDTQLHLDDALRGQEDLKEQLAIVERRAN
LLQAEVEELRATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLTQLQSEVEDACRDAR
NAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLETRI
RELEFELEGEQKRNTESVKGLRKYERRVKELTYQSEEDRKNVLRLQDLVDKLQVKVKSYKRQAEEADEQA
NAHLTKFRKAQHELEEAEERADIAESQVNKLRAKTRDFTSSRMVVHESEE

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 224.2 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001093105
Locus ID 17883
UniProt ID P13541
Cytogenetics 11 40.59 cM
Refseq Size 5992
Refseq ORF 5820
Synonyms MyHC-emb; Myhs; Myhs-; Myhs-e; Myhse
Summary Myosin is a major contractile protein which converts chemical energy into mechanical energy through the hydrolysis of ATP. Myosin is a hexameric protein composed of a pair of myosin heavy chains (MYH) and two pairs of nonidentical light chains. This gene is a member of the MYH family and encodes a protein with an IQ domain and a myosin head-like domain. [provided by RefSeq, Sep 2015]

Documents

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.