Ndrg2 (NM_001145959) Mouse Recombinant Protein

CAT#: TP517629

Purified recombinant protein of Mouse N-myc downstream regulated gene 2 (Ndrg2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Purified recombinant protein Ndrg2 was analyzed by SDS-PAGE gel and Coomossie Blue Staining.

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR217629 representing NM_001145959
  Red=Cloning site Green=Tags(s)
  
  MAELQEVQITEEKPLLPGQTPETAKTHSVETPYGSVTFTVYGTPKPKRPAIFTYHDVGLNYKSCFQPLFR
  FGDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCILQYLNFSTIIGVGVGAGAYILSR
  YALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPDMILGHLFSQEELSGNSELIQKYRGIIQHA
  PNLENIELYWNSYNNRRDLNFERGGETTLKCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQ
  PQLTQPGKLTEAFKYFLQGMGYMASSCMTRLSRSRTASLTSAASIDGSRSRSRTLSQSSESGTLPSGPPG
  HTMEVSC
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001139431
• Locus ID: 29811
• UniProt ID: Q9QYG0
• Cytogenetics: 14 C2
• Refseq Size: 2115
• Refseq ORF: 1071
• Synonyms: AI182517; AU040374; Ndr2; SYLD
• Summary: Contributes to the regulation of the Wnt signaling pathway. Down-regulates CTNNB1-mediated transcriptional activation of target genes, such as CCND1, and may thereby act as tumor suppressor. May be involved in dendritic cell and neuron differentiation (By similarity).[UniProtKB/Swiss-Prot Function]