OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Padi4 (NM_011061) Mouse Recombinant Protein

Be the first to review this product
SKU
TP516758
Purified recombinant protein of Mouse peptidyl arginine deiminase, type IV (Padi4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Padi4 or NM_011061"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR216758 representing NM_011061
Red=Cloning site Green=Tags(s)

MAQGAVIHVAPEQPTHAVCVVGTATPLDVRGSAPKGYTTFGITASPGVIVDVIHGPPVKKSTMGASKWPL
DPELEVTLQVKAASSRTDDEKVRVSYYGPKTSPVQALIYITGVELSLSADVTRTGRVKPAQAGKDQSTWT
WGPGGRGAILLVNCDKEDPQASGMDFEDDKILDNKDLQDMSPMTLSTKTPKDFFEKYQLVLEVPKAKMNR
VRVFRATRGKLPSRYKVALGPQQFSYCLELPGGQHSTDFYVEGLAFPDADFKGLIPLTISLLDKSNPELP
EALVFQDSVTFRVAPWIMTPNTQPPQEVYVCRVSDNEDFLKSLATLTKKAKCKLTVCPEEENIDDQWMQD
EMEIGYIQAPHKTLPVVFDSPRDRGLKDFPVKRVMGPNFGYVTRKLYMSELTGLDAFGNLEVSPPVTVRG
KEYPLGRILIGNSGYSSSESRDMHQALQDFLSAQQVQAPVRLFSDWLFVGHVDEFLSFVPARDKQGFRLL
LSSPRACYQLFQELQSQGHGEATLFEGLKRKRQTINEILSNKKLRDQNAYVESCIDWNRAVLKRELGLAE
GDIIDIPQLFKLAGNSRGNSKAQAFFPNMVNMLVLGKYLGIPKPFGPIIDGHCCLEEEVRSHLEPLGLHC
TFINDFYTYHVYNGEVHCGTNVRRKPFTFKWWHMVP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 74.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_035191
Locus ID 18602
UniProt ID Q9Z183
Cytogenetics 4 72.34 cM
RefSeq Size 2640
RefSeq ORF 1998
Synonyms Pad4; Pdi4
Summary Catalyzes the citrullination/deimination of arginine residues of proteins such as histones, thereby playing a key role in histone code and regulation of stem cell maintenance. Citrullinates histone H1 at 'Arg-54' (to form H1R54ci), histone H3 at 'Arg-2', 'Arg-8', 'Arg-17' and/or 'Arg-26' (to form H3R2ci, H3R8ci, H3R17ci, H3R26ci, respectively) and histone H4 at 'Arg-3' (to form H4R3ci). Acts as a key regulator of stem cell maintenance by mediating citrullination of histone H1: citrullination of 'Arg-54' of histone H1 (H1R54ci) results in H1 displacement from chromatin and global chromatin decondensation, thereby promoting pluripotency and stem cell maintenance. Promotes profound chromatin decondensation during the innate immune response to infection in neutrophils by mediating formation of H1R54ci. Citrullination of histone H3 prevents their methylation by CARM1 and HRMT1L2/PRMT1 and represses transcription. Citrullinates EP300/P300 at 'Arg-2142', which favors its interaction with NCOA2/GRIP1.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products