Zfp706 (NM_026521) Mouse Recombinant Protein

CAT#: TP516379

Purified recombinant protein of Mouse zinc finger protein 706 (Zfp706), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216379 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE
  LADVQA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 8.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080797
• Locus ID: 68036
• UniProt ID: Q9D115, B2RVQ7
• Cytogenetics: 15 B3.1
• Refseq Size: 4485
• Refseq ORF: 231
• Synonyms: 3110006P09Rik; AA793007; AW536850; C77232; Znf706
• Summary: Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4.[UniProtKB/Swiss-Prot Function]