OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Chfr (NM_172717) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509866
Purified recombinant protein of Mouse checkpoint with forkhead and ring finger domains (Chfr), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Chfr or NM_172717"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209866 representing NM_172717
Red=Cloning site Green=Tags(s)

MELHGEEQPPPPQEPWGRLLRLGAEEDEPQILLWKREWTIGRRRGCDLSFPSNKLVSGDHCKLTVDEISG
EVTLEDTSTNGTVINKLQVVKKQTYPLQSGDIIYLVYRKNEPEHNVAYLYESLSGKQSLTQDSLEANKEN
MFHVTKDCSGPGQGDDPQVPLLSPMAQTCLEEPQPSTSTSDLLPTASTSSTEPELTSAGQKHSSSSGPGN
TSISPKGRSSLVANGELSSLSPVFQDKEASFSLLESKDHEELEPAKKKMKGDGELDTNLQLLVSGQRGNA
QTSSEDVKDASVKPDKMEETLTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERICK
NHILNNLVEAYLIQHPDKSRSEEDVRSMDARNKITQDMLQPKVRRSFSDEEGSSEDLLELSDVDSESSDI
SQPYIVCRQCPEYRRQAVQSLPCPVPESELGATLALGGEAPSTSASLPTAPDYMCPLQGSHAICTCCFQP
MPDRRAEREQDPRVAPQQCAVCLQPFCHLYWGCTRTGCFGCLAPFCELNLGDKCLDGVLNNNNYESDILK
NYLATRGLTWKSVLTESLLALQRGVFMLSDYRITGNTVLCYCCGLRSFRELTYQYRQNIPASELPVTVTS
RPDCYWGRNCRTQVKAHHAMKFNHICEQTRFKN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 74.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_766305
Locus ID 231600
UniProt ID Q810L3
Cytogenetics 5 F
RefSeq Size 3166
RefSeq ORF 1989
Synonyms 5730484M20Rik; C230082M18; RNF116
Summary E3 ubiquitin-protein ligase that functions in the antephase checkpoint by actively delaying passage into mitosis in response to microtubule poisons. Acts in early prophase before chromosome condensation, when the centrosome move apart from each other along the periphery of the nucleus. Probably involved in signaling the presence of mitotic stress caused by microtubule poisons by mediating the 'Lys-48'-linked ubiquitination of target proteins, leading to their degradation by the proteasome. Promotes the ubiquitination and subsequent degradation of AURKA and PLK1. Probably acts as a tumor suppressor, possibly by mediating the polyubiquitination of HDAC1, leading to its degradation. May also promote the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress (By similarity).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products