OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Glb1 (NM_009752) Mouse Recombinant Protein

Be the first to review this product
SKU
TP509735
Purified recombinant protein of Mouse galactosidase, beta 1 (Glb1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Glb1 or NM_009752"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR209735 protein sequence
Red=Cloning site Green=Tags(s)

MLRVPLCTPLPLLALLQLLGAAHGIYNVTQRTFKLDYSRDRFLKDGQPFRYISGSIHYFRIPRFYWEDRL
LKMKMAGLNAIQMYVPWNFHEPQPGQYEFSGDRDVEHFIQLAHELGLLVILRPGPYICAEWDMGGLPAWL
LEKQSIVLRSSDPDYLVAVDKWLAVLLPKMKPLLYQNGGPIITVQVENEYGSYFACDYDYLRFLVHRFRY
HLGNDVILFTTDGASEKMLKCGTLQDLYATVDFGTGNNITQAFLVQRKFEPKGPLINSEFYTGWLDHWGK
PHSTVKTKTLATSLYNLLARGANVNLYMFIGGTNFAYWNGANTPYEPQPTSYDYDAPLSEAGDLTKKYFA
LREVIQMFKEVPEGPIPPSTPKFAYGKVALRKFKTVAEALGILCPNGPVKSLYPLTFTQVKQYFGYVLYR
TTLPQDCSNPKPIFSSPFNGVRDRAYVSVDGVPQGILDRNLMTALNIQGKAGATLDILVENMGRVNYGRF
INDFKGLISNMTINSTVLTNWTVFPLDTEAMVRNHLWGREASDGGHLDGRSTSNSSDLILPTFYVGNFSI
PSGIPDLPQDTFIQFPGWSKGQVWINGFNLGRYWPTMGPQKTLFVPRNILTTSAPNNITVLELEFAPCSE
GTPELCTVEFVDTPVIS

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 73 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_033882
Locus ID 12091
UniProt ID P23780
Cytogenetics 9 64.4 cM
RefSeq Size 2396
RefSeq ORF 1941
Synonyms AW125515; Bg; Bge; Bgl; Bgl-; Bgl-e; Bgl-s; Bgl-t; Bgs; Bgt; C130097A14Rik
Summary This gene encodes a preproprotein that is proteolytically cleaved to yield a signal peptide and a proproptein that is subsequently processed to generate the active mature peptide. The encoded protein is a lysosomal enzyme that catalyzes the hydrolysis of terminal beta-D-galactose residues in various substrates like lactose, ganglioside GM1 and other glycoproteins. Mutations in the human gene are associated with GM1-gangliosidosis and Morquio B syndrome. Disruption of the mouse gene mirrors the symptoms of human gangliosidosis. Alternative splicing results in multiple transcript variants. provided by RefSeq, Dec 2013
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

A GLB1 transgene with enhanced therapeutic potential for the preclinical development of ex-vivo gene therapy to treat mucopolysaccharidosis type IVB
Crippa, Alberti, Passerini et al
Molecular Therapy - Methods & Clinical Development (2024) 32 (3), 101313 DOI: 10.1016/j.omtm.2024.101313
Cited by 4
AI Summary: OriGene’s recombinant murine β-GAL (product TP509735) was used to generate a calibration curve for enzymatic activity assays in the study, enabling accurate measurement of β-GAL activity in gene therapy experiments for mucopolysaccharidosis type IVB.
Snippet: CM untransduced and transduced (LV-Glb1 WT, LV-Glb1 C2C12, and LV-GLB1) HEK293T cells, a calibration curve was built upon testing the enzymatic activity of serial dilutions of a 10 μL solution containing known concentration of recombinant human (rh) (Biotechne, 6464-GH) or murine (rm) (Origene, TP509735) β-GAL. …
Preclinical development of hematopoietic stem cell-gene therapy for Mucopolysaccharidosis type IVB using a GLB1 transgene with enhanced therapeutic potential
Crippa, Alberti, Passerini et al
Thesis (2024)
Snippet: HEK293T cells, a calibration curve was built upon testing the enzymatic activity of serial dilutions of a 10 μL solution containing known concentration of recombinant human (rh) (Biotechne, 6464-GH) or murine (rm) (Origene, TP509735) β-GAL. A logarithmic trendline best fitted results of rm β-GAL activity, while linear correlation best fitted rh β-GAL up to 350 nmol/mg/h. …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products