Enox2 (NM_145951) Mouse Recombinant Protein

CAT#: TP509287

Purified recombinant protein of Mouse ecto-NOX disulfide-thiol exchanger 2 (Enox2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209287 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLPVSDPAAWATAMNNLGMAPLGIAGQPILPDFDPALGMMTGIPPITPMMPGLGIVPPPIPPDMPVAKE
  IIHCKSCTLFPPNPNLPPPATRERPPGCKTVFVGGLPENGTEQIIVEVFEQCGEIIAIRKSKKNFCHIRF
  AEEYMVDKALYLSGYRIRLGSSTDKKDTGRLHVDFAQARDDLYEWECKQRMLAREERHRRRMEEERMRPP
  SPPPVVHYSDHECSIVAEKLKDDSKFSEAVQTLLTWIERGEVNRRSANHFYSMIQSANSHVRRLVNEKAT
  HEKEMEEAKEKFKQALSGILIQFEQIVAVYHSASKQKAWDHFTKAQRKNISVWCKQAEEIRNIHNDELMG
  IRREEEMEMSDDEIEETTETKETEESALVSQAEALKEENDSLRWQLDAYRNEVELLKQEQGKAHREDDPN
  KEQQLKLLQQALQGMQQHLLKVQEEYKKKEAELDRIKDDNLQVEQLLENFHEKQENCGSRLCASSQEGEQ
  PLEKTAVSNPVKSEREALLVGIISTFLHVHPFGASIEYICSYLNRLDNKASYQIPSKLTTSPLLPISTSD
  VESLMSRLQHTFRQEMTGVGASLEKRWKFCGFEGLKLT
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 68.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666063
• Locus ID: 209224
• UniProt ID: Q8R0Z2, Q3UZA6
• Cytogenetics: X A5
• Refseq Size: 3921
• Refseq ORF: 1797
• Synonyms: APK1; Cova1; tNOX
• Summary: May be involved in cell growth. Probably acts as a terminal oxidase of plasma electron transport from cytosolic NAD(P)H via hydroquinones to acceptors at the cell surface. Hydroquinone oxidase activity alternates with a protein disulfide-thiol interchange/oxidoreductase activity which may control physical membrane displacements associated with vesicle budding or cell enlargement. The activities oscillate with a period length of 22 minutes and play a role in control of the ultradian cellular biological clock (By similarity).[UniProtKB/Swiss-Prot Function]