Gad1 (NM_008077) Mouse Recombinant Protein

CAT#: TP509243

Purified recombinant protein of Mouse glutamate decarboxylase 1 (Gad1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR209243 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASSTPSPATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFRERQ
  SSKNLLSCENSDQGARFRRTETDFSNLFAQDLLPAKNGEEQTAQFLLEVVDILLNYVRKTFDRSTKVLDF
  HHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGLAGEWLTSTANT
  NMFTYEIAPVFVLMEQITLKKMREIVGWSNKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPK
  LVLFTSEHSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADLEAKILDAKQKGYVPLYVNATAGTTVYG
  AFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERANSVTWNPHKMMGVLLQCSAILVKEK
  GILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELADYLY
  AKIKNREEFEMVFDGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAPKIKALMMESGTTMVGYQPQGD
  KANFFRMVISNPAATQSDIDFLIEEIERLGQDL
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 66.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_032103
• Locus ID: 14415
• UniProt ID: P48318, Q548L6
• Cytogenetics: 2 41.63 cM
• Refseq Size: 3231
• Refseq ORF: 1782
• Synonyms: EP1; EP10; Gad-; Gad-1; GAD2; GAD4; GAD6
• Summary: The protein encoded by this gene is an enzyme that catalyzes the production of gamma-aminobutyric acid from L-glutamic acid. Alternative splicing of this gene results in two products, the predominant 67 kDa isoform and a smaller 25 kDa isoform. The smaller isoform is not thought to retain catalytic activity. [provided by RefSeq, Aug 2015]