Ubqln1 (NM_152234) Mouse Recombinant Protein

CAT#: TP508794

Purified recombinant protein of Mouse ubiquilin 1 (Ubqln1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR208794 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAESAESGGPPGAQDSAADGGPAEPKIMKVTVKTPKEKEEFAVPENSSVQQFKEEISKRFKSHIDQLVLI
  FAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDNSAQQTNAPGSTVTSSPAPDSNPTSGSAANSSFGV
  GGLGGLAGLSSLGLNTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLI
  QRNPEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQEPMLNAAQE
  QFGGNPFASLVSSSSSAEGTQPSRTENRDPLPNPWAPQTSQSSPASGTTGSTTNTMSTSGGTATSTPAGQ
  STSGPSLVPGAGASMFNTPGMQSLLQQITENPQLMQNMLSAPYMRSMLQSLSQNPDLAAQMQNPDTLSAM
  SNPRAMQALLQIQQGLQTLATEAPGLIPGFTPGLAAGNSGGSSGTNAPSTAPSEDTNPQGGTAEPGHQQF
  IQQMLQALAGVNPQLQSPEVRFQQQLEQLSAMGFLNREANLQALIATGGDINAAIERLLGSQPS
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 58.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689420
• Locus ID: 56085
• UniProt ID: Q8R317, Q3TN93
• Cytogenetics: 13 30.95 cM
• Refseq Size: 3609
• Refseq ORF: 1665
• Synonyms: 1110046H03Rik; 1810030E05Rik; AU019746; C77538; D13Ertd372e; Da41; Dsk2; Plic-1; Plic1; Xdrp1
• Summary: Plays an important role in the regulation of different protein degradation mechanisms and pathways including ubiquitin-proteasome system (UPS), autophagy and endoplasmic reticulum-associated protein degradation (ERAD) pathway. Mediates the proteasomal targeting of misfolded or accumulated proteins for degradation by binding (via UBA domain) to their polyubiquitin chains and by interacting (via ubiquitin-like domain) with the subunits of the proteasome. Plays a role in the ERAD pathway via its interaction with ER-localized proteins UBXN4, VCP and HERPUD1 and may form a link between the polyubiquitinated ERAD substrates and the proteasome. Plays a role in unfolded protein response (UPR) by attenuating the induction of UPR-inducible genes, DDTI3/CHOP, HSPA5 and PDIA2 during ER stress. Involved in the regulation of macroautophagy and autophagosome formation; required for maturation of autophagy-related protein LC3 from the cytosolic form LC3-I to the membrane-bound form LC3-II and may assist in the maturation of autophagosomes to autolysosomes by mediating autophagosome-lysosome fusion. Negatively regulates the TICAM1/TRIF-dependent toll-like receptor signaling pathway by decreasing the abundance of TICAM1 via the autophagic pathway. Plays a key role in the regulation of the levels of PSEN1 by targeting its accumulation to aggresomes which may then be removed from cells by autophagocytosis. Promotes the ubiquitination and lysosomal degradation of ORAI1, consequently downregulating the ORAI1-mediated Ca2+ mobilization. Suppresses the maturation and proteasomal degradation of amyloid beta A4 protein (A4) by stimulating the lysine 63 (K63)-linked polyubiquitination. Delays the maturation of A4 by sequestering it in the Golgi apparatus and preventing its transport to the cell surface for subsequent processing (By similarity). Links CD47 to the cytoskeleton (PubMed:10549293).[UniProtKB/Swiss-Prot Function]