OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Asz1 (NM_023729) Mouse Recombinant Protein

Be the first to review this product
SKU
TP507612
Purified recombinant protein of Mouse ankyrin repeat, SAM and basic leucine zipper domain containing 1 (Asz1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Asz1 or NM_023729"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR207612 protein sequence
Red=Cloning site Green=Tags(s)

MAAGTLRGLAVAGGGESSDSEDDGWDIGYLDRSSQKLKRSLPVEEKNETFKKALTTGDISLVKELLDSGI
NVDSSFRYGWTPLMYAASVANAELVRFLLDRGANASFDKDKLTILISACSARGSEEQVLKCVELLLSRNA
DPNTACRRLMTPIMYAARDGHTQVVALLVAHGAEVNAQDENGYTALTWAARQGHKNVILKLLELGANKML
QTKDGRTPSEIAKRNKHLEIFNFLSLTLNPLEGKLQQLAKEETICKLLATDSDKEKDHIFSPYTAFGDLE
IFLHGLGLEHMTDSLKEKDITLRHLLTMKKDELTKNGIASKDQQKILAALKELEVEEINFGKLPEVTKLE
ISGDEFLNFLLKLNKQCGHLITAVQNIITELPVNSHKIVLEWASPRNFTSVCEELVSNVEDLNEEVCRLK
ELIQKMQNERENDPTHIPLVEEVSTWKTRILKRSAVTVCGFGLLLFIGKLTLQRK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 53 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076218
Locus ID 74068
UniProt ID Q8VD46
Cytogenetics 6 A2
RefSeq Size 1740
RefSeq ORF 1425
Synonyms 4933400N19Rik; Gasz; ORF3
Summary Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Its association with pi-bodies suggests a participation in the primary piRNAs metabolic process. Required prior to the pachytene stage to facilitate the production of multiple types of piRNAs, including those associated with repeats involved in regulation of retrotransposons. May act by mediating protein-protein interactions during germ cell maturation.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Membrane Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products