Fktn (NM_139309) Mouse Recombinant Protein

CAT#: TP507355

Purified recombinant protein of Mouse fukutin (Fktn), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Images

Coomassie blue staining of purified Fktn protein (Cat# TP507355). The protein was produced from HEK293T cells transfected with Fktn cDNA clone (Cat# MR207355) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207355 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRINKNVVLALLTLTSSAFLLFQLYYYKHYLSARNGLGSSKSKGNRVGFDSTQWRAVKKFIMLTSSQNV
  PVFLIDPWILESINKNFEQVKNASQGPASECRFFCVPRDFTAFALQYHLWKNEDGWFRIAENMGFQCLKT
  ESKDPRLDGIDSLSGTEIPLHYVCKLTTHAIHLVVFHERSGNYLWHGHLRLKGHMDRKFVPFRKLQFGRY
  PGAFDRPELQQVTVDGLDMLIPKDPGRFLEEVPHSRFIECRYKEARAFLQQYIDDNTVDAMVFRKRAKEL
  LQLAAKTLKDLGVPFWLSSGTCLGWYRQCGIIPYSKDVDLGIFIQDYKPDIILAFQEAGLPLKHKFGKVE
  DSLELSFQGKNDVKLDIFFFYEEADHLWNGGTQARTGKKFKYLFPKFTLCWTEFVDIKVHVPCETVDYIE
  ANYGKTWKIPIKTWDWKSSPPNVQPNGIWPISEWDEVIQLY
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 53.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_647470
• Locus ID: 246179
• UniProt ID: Q8R507
• Cytogenetics: 4 28.74 cM
• Refseq Size: 3382
• Refseq ORF: 1386
• Synonyms: D830030O17Rik; Fcmd
• Summary: Catalyzes the transfer of CDP-ribitol to the distal N-acetylgalactosamine of the phosphorylated O-mannosyl trisaccharide (N-acetylgalactosamine-beta-3-N-acetylglucosamine-beta-4-(phosphate-6-)mannose), a carbohydrate structure present in alpha-dystroglycan (DAG1) (PubMed:12471058). This constitutes the first step in the formation of the ribitol 5-phosphate tandem repeat which links the phosphorylated O-mannosyl trisaccharide to the ligand binding moiety composed of repeats of 3-xylosyl-alpha-1,3-glucuronic acid-beta-1 (By similarity). Required for normal location of POMGNT1 in Golgi membranes, and for normal POMGNT1 activity (PubMed:19017726). May interact with and reinforce a large complex encompassing the outside and inside of muscle membranes (PubMed:19017726, PubMed:22922256). Could be involved in brain development (Probable).[UniProtKB/Swiss-Prot Function]