OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Idh2 (NM_173011) Mouse Recombinant Protein

Be the first to review this product
SKU
TP507208
Purified recombinant protein of Mouse isocitrate dehydrogenase 2 (NADP+), mitochondrial (Idh2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Idh2 or NM_173011"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR207208 representing NM_173011
Red=Cloning site Green=Tags(s)

MAGYLRAVSSLCRASGSARTWAPAALTVPSWPEQPRRHYAEKRIKVEKPVVEMDGDEMTRIIWQFIKEKL
ILPHVDVQLKYFDLGLPNRDQTNDQVTIDSALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIR
NILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVVDRAGTFKLVFTPKDGSSAKEWEVY
NFPAGGVGMGMYNTDESISGFAHSCFQYSIQKKWPLYLSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDK
NKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGT
VTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKVCVQTVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGKQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 51.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_766599
Locus ID 269951
UniProt ID P54071
Cytogenetics 7 45.43 cM
RefSeq Size 1718
RefSeq ORF 1356
Synonyms E430004F23; Idh-2; IDPm
Summary Plays a role in intermediary metabolism and energy production. It may tightly associate or interact with the pyruvate dehydrogenase complex.UniProtKB/Swiss-Prot Function
Protein Categories Cancer: Haematopoietic and Lymphoid, Cardiovascular diseases, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Cancer-associated metabolite 2-hydroxyglutarate accumulates in acute myelogenous leukemia with isocitrate dehydrogenase 1 and 2 mutations
Gross, Cairns, Minden et al
J Exp Med (2010) 207 (2), 339-44 DOI: 10.1084/jem.20092506
Cited by 733
AI Summary: In this study, OriGene's recombinant human IDH1 and IDH2 proteins were used to demonstrate that mutant IDH1 R132C and IDH2 R172K enzymes catalyze the production of 2-hydroxyglutarate, linking these mutations to altered metabolism in acute myelogenous leukemia.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products