Sqor (NM_021507) Mouse Recombinant Protein

CAT#: TP507186

Purified recombinant protein of Mouse sulfide quinone oxidoreductase (Sqor), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR207186 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPLVAVVSSPRARLFACFLRLGTQQAGPLQLHTGACCTAKNHYEVLVLGGGAGGITMATRMKRRVGAEN
  VAIVEPSERHFYQPIWTLVGAGAKELSLSVRSTLSVIPSGVQWIQDRVAELNPDENCIRTDSGKEISYRY
  LIIALGIQLDYEKIKGLPEGFAYPKIGSNYSVKTVEKTWKALQDFKEGNALFTFPNTPVKCAGAPQKIMY
  LSEAYFRKTGKRPKANIIFNTALGTIFGVKKYADALQEIIRERDVSVNYKHNLIEVRPDKQEAVFEILDK
  PGETHVIPYEMLHVTPPMSAPDVLKRSPVADSAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAVA
  AQSGILDRTMCLIMKNQRPIKKYDGYTSCPLVTGYNRVILAEFDYTAQPLETFPFDQSKERITMYLMKAD
  MMPFLYWNMMLRGYWGGPAFLRKLFHLGMN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 50.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067482
• Locus ID: 59010
• UniProt ID: Q9R112
• Cytogenetics: 2 E5
• Refseq Size: 1995
• Refseq ORF: 1353
• Synonyms: 0610039J17Rik; 4930557M22Rik; SQOR; Sqrdl
• Summary: Catalyzes the oxidation of hydrogen sulfide with the help of a quinone, such as ubiquinone, giving rise to thiosulfate and ultimately to sulfane (molecular sulfur) atoms. Requires an additional electron acceptor; can use sulfite, sulfide or cyanide (in vitro).[UniProtKB/Swiss-Prot Function]