OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rusc1 (NM_028188) Mouse Recombinant Protein

Be the first to review this product
SKU
TP506880
Purified recombinant protein of Mouse RUN and SH3 domain containing 1 (Rusc1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rusc1 or NM_028188"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR206880 protein sequence
Red=Cloning site Green=Tags(s)

MAEAQSGTGQLQEQKKGLLIAVSASVDKIISHFGAARNLVQKAQLGDSRLSPDVGHLVLTTLCPALHALV
ADGLKPFRKDLITGQRRSSPWSVVEASVKPGSCTHSMGSLYSQVSRLAPLSSSRSRFHAFILGLLNTKQL
ELWFSSLQEDAGLLSLLYLPTGFFSLARGSCPSLATELLLLLQPLSVLTFHLDLLFEHHHHLPVGLQQAP
APSCPPPALQQTMQAVLHWGERLAQSLRGTSGESTTDSSTPSARPPAGSWWDQLTQASRVYASGGTEGFP
LLRWGPRRHGTTAEAAQEAPPPTEQTTPGRSVWLGRLFGVPGCPSETESGAFKSRRPSSWLPPTVSVLAL
VKRGTPPETPPEALVSSPGSVVQADRAVRALCDHTAAGPDQLSFQRGELLRVIATVDEDWLRCGRDGVEG
LVPVGYTSLVL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 46.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_082464
Locus ID 72296
UniProt ID Q8BG26
Cytogenetics 3 F1
RefSeq Size 3799
RefSeq ORF 1293
Synonyms 2210403N08Rik; AA408288; NESCA
Summary Putative signaling adapter which may play a role in neuronal differentiation. May be involved in regulation of NGF-dependent neurite outgrowth. Proposed to play a role in neuronal vesicular trafficking, specifically involving pre-synaptic membrane proteins. Seems to be involved in signaling pathways that are regulated by the prolonged activation of MAPK. Can regulate the polyubiquitination of IKBKG and thus may be involved in regulation of the NF-kappa-B pathway.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products