Gatm (NM_025961) Mouse Recombinant Protein

CAT#: TP506739

Purified recombinant protein of Mouse glycine amidinotransferase (L-arginine:glycine amidinotransferase) (Gatm), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206739 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MLRVRCLRGGSRGAEAVHYIGSRLGGSLTGWVQRTFQSTQAATASSRNSCAAEDKATHPLPKDCPVSSYN
  EWDPLEEVIVGRAENACVPPFTVEVKANTYEKYWPFYQKNGGLYFPKDHLKKAVAEVEEMCNILSMEGVT
  VRRPDPIDWSLKYKTPDFESTGLYSAMPRDILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKW
  TTAPKPTMADELYDQNYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEW
  MRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHP
  LWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRRGTLQS
  YFD
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 48.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_080237
• Locus ID: 67092
• UniProt ID: Q9D964
• Cytogenetics: 2 60.63 cM
• Refseq Size: 2357
• Refseq ORF: 1272
• Synonyms: 1810003P21Rik; AI314789; AT
• Summary: Catalyzes the biosynthesis of guanidinoacetate, the immediate precursor of creatine. Creatine plays a vital role in energy metabolism in muscle tissues. May play a role in embryonic and central nervous system development.[UniProtKB/Swiss-Prot Function]