Wdr12 (NM_021312) Mouse Recombinant Protein

CAT#: TP506730

Purified recombinant protein of Mouse WD repeat domain 12 (Wdr12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206730 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAQLQARFYSENKKYAVDDVPFSIPAAAEVADLSNIINKLLETKNELHKHVEFDFLIKGQFLRVPLVKHM
  ELENISSEEVVELEYVEKYTAPQPEQCMFHDDWISSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHT
  DVVKDVAWVKKDSLSCLLLTASMDQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWD
  KMLKIWSTVPTDEEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAEEICSASWDHTI
  RVWDVESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTSHTGWVTSVKW
  SPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYSYSPTTSH
  VGA
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 47.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067287
• Locus ID: 57750
• UniProt ID: Q9JJA4, Q4V9X1
• Cytogenetics: 1 C2
• Refseq Size: 2946
• Refseq ORF: 1272
• Synonyms: 4933402C23Rik; Ytm1; Ytm1p
• Summary: Component of the PeBoW complex, which is required for maturation of 28S and 5.8S ribosomal RNAs and formation of the 60S ribosome.[UniProtKB/Swiss-Prot Function]