Cdc42ep1 (NM_027219) Mouse Recombinant Protein

CAT#: TP506427

Purified recombinant protein of Mouse CDC42 effector protein (Rho GTPase binding) 1 (Cdc42ep1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206427 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPGPQGGTGAPTMSLGKLSPVGWVSSSHGKRRLTADMISPPLGDFRHTMHVGRGGDVFGDTSFLSNHGGR
  SGNTHRSPRSFLARKLQQVRRVGVPPRRMASPAAPSPAPPPISPIIKNAISLPQLNQATYDSLVMGKLSF
  DSTPASSTDGHSGYGLESGFCTISRLPRVEKHSNRDRDRDPDHSQDREQSSFPSEPTPNPELRRSDSLLS
  FRFDLDLGPSLLSELLGVMSLSEAPAAETPVPTANPPAPAANPAPTAKPPAHAITTLDAVTSLPASAVTS
  LPAPAAASSPSRGHFPNGVTSVLGPAAEAKPSPVGEGPQVPSNMTFDRHGASWGASRASWGASRASRHYT
  EMDARRELAGVLPQVHGSWESLNEDWSTPPASVRAPVPTSVQVNAFEFADAEEDDEVKV
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Tag: C-MYC/DDK
• Predicted MW: 43.1 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_081495
• Locus ID: 104445
• UniProt ID: Q91W92, A0A0R4J0S1
• Cytogenetics: 15 E1
• Refseq Size: 2542
• Refseq ORF: 1230
• Synonyms: 1810058K22Rik; AA980734; Borg5; CEP1; MSE55
• Summary: Probably involved in the organization of the actin cytoskeleton. Induced membrane extensions in fibroblasts (By similarity).[UniProtKB/Swiss-Prot Function]