Tbc1d13 (NM_146252) Mouse Recombinant Protein

CAT#: TP506283

Purified recombinant protein of Mouse TBC1 domain family, member 13 (Tbc1d13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206283 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSLHKSRIADFQDVLKEPSIVLEKLRELSFSGIPCEGGLRCLCWKILLNYLPLERASWTSILAKQRGLY
  SQFLREMIIQPGIAKANMGVFREDVTFEDHPLNPNPDSRWNTYFKDNEVLLQIDKDVRRLCPDISFFQRA
  TEYPCLLILDPQNEFETLRKRVEQTTLKSQTVARNRSGVTNMSSPHKNSAPSALNEYEVLPNGCEAHWEV
  VERILFIYAKLNPGIAYVQGMNEIVGPLYYTFATDPNSEWKEHAEADTFFCFTNLMAEIRDNFIKSLDDS
  QCGITYKMEKVYSTLKDKDVELYLKLQEQSIKPQFFAFRWLTLLLSQEFLLPDVIRIWDSLFADGNRFDF
  LLLVCCAMLILIREQLLEGDFTVNMRLLQDYPITDVCQILQKAKELQDSK
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 46.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666364
• Locus ID: 70296
• UniProt ID: Q8R3D1, Q3TZ63
• Cytogenetics: 2 B
• Refseq Size: 3487
• Refseq ORF: 1203
• Synonyms: 2600014A06Rik; BC025586
• Summary: Acts as a GTPase-activating protein for RAB35. Together with RAB35 may be involved in regulation of insulin-induced glucose transporter SLC2A4/GLUT4 translocation to the plasma membrane in adipocytes.[UniProtKB/Swiss-Prot Function]