Nr2e3 (NM_013708) Mouse Recombinant Protein

CAT#: TP506173

Purified recombinant protein of Mouse nuclear receptor subfamily 2, group E, member 3 (Nr2e3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR206173 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSTVAASTMPVSVAASKKESPGRWGLGEDPTGVGPSLQCRVCGDSSSGKHYGIYACNGCSGFFKRSVRR
  RLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSMAQVHLDAMETGSDPRSEPVV
  ASPALAGPSPRGPTSVSATRAMGHHFMASLITAETCAKLEPEDAEENIDVTSNDPEFPASPCSLDGIHET
  SARLLFMAVKWAKNLPVFSNLPFRDQVILLEEAWNELFLLGAIQWSLPLDSCPLLAPPEASGSSQGRLAL
  ASAETRFLQETISRFRALAVDPTEFACLKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQP
  VRFGKLLLLLPSLRFLTAERIELLFFRKTIGNTPMEKLLCDMFKN
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 43.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_038736
• Locus ID: 23958
• UniProt ID: Q9QXZ7, Q543C7
• Cytogenetics: 9 32.35 cM
• Refseq Size: 1999
• Refseq ORF: 1188
• Synonyms: A930035N01Rik; PNR; rd7; RNR
• Summary: Orphan nuclear receptor of retinal photoreceptor cells. Transcriptional factor that is an activator of rod development and repressor of cone development. Binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. Enhances rhodopsin expression. Represses M- and S-cone opsin expression.[UniProtKB/Swiss-Prot Function]