OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Zfp24 (NM_021559) Mouse Recombinant Protein

Be the first to review this product
SKU
TP505667
Purified recombinant protein of Mouse zinc finger protein 24 (Zfp24), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Size:
20 ug
  $1,020.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Zfp24 or NM_021559"

Specifications
Specifications
Product Data
Species Mouse
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR205667 protein sequence
Red=Cloning site Green=Tags(s)

MSAQSVEEDSILIIPNPDEEEKILRVKLEEDPDGEEGSSISWNHLPDPEVFRQRFRQFGYQDSPGPREAV
SQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVREHHPENGEEAVAVLEDLESELDDPGQP
VSLRRQKREVLVEEITSQEDAQGLPSSELDAVENQLKWASWELHSLRHCDDDATTENGALAPKQEMASAG
ESHEGPGTLNIGVPQLFKYGETCFPKGRFERKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYG
CVECGKAFSRSSILVQHQRVHTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNL
FRHQRRHNAEKLLNVVKV

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 41.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_067534
Locus ID 59057
UniProt ID Q91VN1
Cytogenetics 18 A2
RefSeq Size 3143
RefSeq ORF 1104
Synonyms 3526401F17Rik; 5033419P20Rik; AI480505; AI642085; AL024422; KOX17; ZF-12; Zfp191; Znf24; Znf191
Summary Transcription factor required for myelination of differentiated oligodendrocytes. Required for the conversion of oligodendrocytes from the premyelinating to the myelinating state. In the developing central nervous system (CNS), involved in the maintenance in the progenitor stage by promoting the cell cycle. Specifically binds to the 5'-TCAT-3' DNA sequence. Has transcription repressor activity in vitro.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products