Slc25a3 (NM_133668) Mouse Recombinant Protein

CAT#: TP505459

Purified recombinant protein of Mouse solute carrier family 25 (mitochondrial carrier, phosphate carrier), member 3 (Slc25a3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205459 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFSSVAHLARANPFNAPHLQLVHDGLSGPRSPPAPPRRSRHLAAAAVEEYSCEFGSMKYYALCGFGGVLS
  CGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSITLKEDGVRGLAKGWAPTLIGYSMQGLCKFGFYEVFK
  ALYSNILGEENTYLWRTSLYLASSASAEFFADIALAPMEAAKVRIQTQPGYANTLREAVPKMYKEEGLNA
  FYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSECTKAEQLVVTFVAGYIAGVFCAIVSHPAD
  SVVSVLNKEKGSTASQVLQRLGFRGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLK
  KKLGLTE
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 39.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_598429
• Locus ID: 18674
• UniProt ID: Q8VEM8
• Cytogenetics: 10 C2
• Refseq Size: 1512
• Refseq ORF: 1074
• Synonyms: 5730556H19Rik; Phc; PTP
• Summary: Transport of phosphate groups from the cytosol to mitochondrial matrix. Phosphate is cotransported with H(+). May play a role regulation of the mitochondrial permeability transition pore (mPTP) (By similarity).[UniProtKB/Swiss-Prot Function]