Ppp1r8 (NM_146154) Mouse Recombinant Protein

CAT#: TP505326

Purified recombinant protein of Mouse protein phosphatase 1, regulatory subunit 8 (Ppp1r8), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Specifications

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR205326 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAVNSGSSLPLFDCPTWAGKPPPGLHLDVVKGDKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRV
  HAALVYHKHLKRVFLIDLNSTHGTFLGHIRLEPHKPQQIPIDSTVSFGASTRAYTLREKPQTLPSAVKGD
  EKMGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEII
  NPEDVDPSVGRFRNMVQTAVVPVKKKRMEGSGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSETGSQPHG
  IHGTALIGGLPMPYPNLAPDVDLTPVVPSAVAINPTPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLL
  I
  
  myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 38.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_666266
• Locus ID: 100336
• UniProt ID: Q8R3G1
• Cytogenetics: 4 D2.3
• Refseq Size: 2060
• Refseq ORF: 1056
• Synonyms: 6330548N22Rik; AU044684; NIPP1
• Summary: Inhibitor subunit of the major nuclear protein phosphatase-1 (PP-1). It has RNA-binding activity but does not cleave RNA and may target PP-1 to RNA-associated substrates. May also be involved in pre-mRNA splicing. Binds DNA and might act as a transcriptional repressor. Essential for cell proliferation and early embryonic development.[UniProtKB/Swiss-Prot Function]